KEGG   Miniopterus natalensis: 107528068
Entry
107528068         CDS       T05883                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04912  GnRH signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05200  Pathways in cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107528068 (PLD2)
   00565 Ether lipid metabolism
    107528068 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107528068 (PLD2)
   04072 Phospholipase D signaling pathway
    107528068 (PLD2)
   04071 Sphingolipid signaling pathway
    107528068 (PLD2)
   04024 cAMP signaling pathway
    107528068 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107528068 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107528068 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107528068 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    107528068 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107528068 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528068 (PLD2)
   05231 Choline metabolism in cancer
    107528068 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107528068 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107528068 (PLD2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107528068 (PLD2)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107528068 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    107528068 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 107528068
NCBI-ProteinID: XP_016056486
LinkDB
Position
Unknown
AA seq 930 aa
MTASPESLFPSGGDLDSNQLQMEPDEVDTLREGEDPADRMHPFLAIYDLQPLKMHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAIPYPPAREAADREIPSLPRAGPEGSTRHASSKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPELGSKGLEGVIRKRSGGHRVPGLNCCGRDQVCYRWSKRWLVV
KDSFLLYMCIETGTISFVQLFDPGFGVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQAR
WWGQEITELAQGLGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILQAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALSINSGYSKRAL
VLLHPNIKVMRHPDHVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SATPQPPTPCSDSPDISHNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRKTTARMPWRDV
GVVVHGPPARDLARHFIQRWNFTKTTKAKYKTPMYPYLLPKSTSTANQLPFTLPGGQCAT
VQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVD
RILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSVLHRLKA
AMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLLGKR
DSELAVLIEDTEMEPSLMDGAEYQAGRFALSLRKHCFSVVLGADARPDLDLRDPVCDDFF
QLWQDTAENNANIYEQIFRCLPSNATRSLRALREYVAVEPLAMVSPPLARSELTQVQGHL
VHFPLKFLEDESLLPPLSSKEGMMPIEVWT
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgacggccagcccagagagcctgttcccttctgggggcgacctggactccaaccagtta
cagatggagcccgatgaggtggacactctgagggagggagaggacccagctgaccggatg
cacccctttctggccatctatgaccttcagcctctgaaaatgcaccccttggtatttgcc
cctggggttcctgtcacggcccaggtggtgggcactgaaagatataccagtggatccaag
gtgggcacctgcactctgtattctgtccgcttgactcatggcgactttacctggacaacc
aagaagaagttccgtcatttccaggagctacatcgggacctcctgagacacaaagtcttg
atgagtctgcttcctctggctcgctttgctattccctatcctccagcccgggaggcagcc
gacagagagataccgtccctaccccgagcaggtcctgagggctccaccagacatgcatcc
agcaaacagaaatacttggagaattacctcaatcgcctcctgaccatgtctttctaccgc
aactaccacgccatgacagagttcctggaagtcagtcagctgtcctttatcccagagctt
ggatctaaaggactggaaggggtgatccggaagcgctctgggggccaccgtgttcctggc
cttaactgctgtggccgagaccaagtttgctatcgctggtccaagaggtggctggtggtg
aaggattccttcctgctgtacatgtgcatcgagacaggcaccatctcatttgttcagctc
ttcgaccctggctttggcgtgcaggtggggaagaggagcacagagacacggtacggggtc
cggatcgacacctcccacaggtccctgattctcaagtgcagcagctaccggcaggcacgg
tggtggggccaggaaatcactgagctggcccagggcctgggcagagacttcctgcagctg
caccggcatgacagctatgctccgccccggcctgggactttggcacggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatcctgcaagctcaagaggagattttc
atcacagactggtggttgagccctgagatttatctgaagcgtccagcccattcagatgac
tggagactggacattatgctcaagaagaaggcggaggagggtgtccgtgtgtccgtacta
ctgtttaaggaagtggagttggccttgagcatcaacagtggctatagcaagagggctctg
gtgctgctgcaccccaacataaaggtgatgcgccacccagaccatgtgacattgtgggcc
catcatgagaagctcctggtggtggaccaagtcgtggccttcttgggaggtctggatctc
gcctatggccgctgggatgacctgcactaccgactgactgaccttggggattcctctgaa
tcagctaccccacagccacctaccccgtgctcagactctccagacatctctcataaccaa
ctcttctggctgggcaaggactacagcaatcttatcactaaggactgggtacagctggac
cggccttttgaagatttcattgacaggaagaccacagcccggatgccatggcgggatgtt
ggggtggttgtccatggcccacctgcccgggacctggcccggcacttcatccagcgctgg
aacttcactaagactaccaaggccaagtacaagacacccatgtacccctacctgctgccc
aagtctaccagcaccgcaaaccagctccccttcacactcccaggggggcagtgtgccacc
gtgcaggtcttgcggtcagtggaccgctggtcagcagggactttggagaactccatcctc
aatgcctacctgcacaccatcagggagagccagcacttcctctacattgagaatcagttc
ttcattagctgctcagatggacggacagttctgaacaaggtgggcgatgagattgtggac
agaatcctgaaggcccacaaacaggggcaatgcttccgagtctacgtgcttctgcccctg
ctccctggatttgagggtgacatctccacaggtggtggtaactccatccaagccattctg
cacttcacttacaggaccctgtgtcgtggagaatattcagtcctgcatcgcctcaaagca
gccatggggacagcatggagggactatatatccatctgtgggctccgaacacatggagag
ctgggtgggcacccagtctcagagctcatctacatccacagcaagatgctcattgctgat
gaccggacagtcatcattggctctgcgaacatcaatgaccggagcctgctggggaagcgg
gacagtgagctggccgtgctgattgaggacacggagatggagccatccctcatggatggt
gcagagtaccaagcgggcaggtttgccttgagtttgcggaagcactgcttcagcgtggtt
ctcggggcagatgcccggccagacctggatctccgagaccctgtctgtgatgacttcttc
cagttgtggcaagacacggctgagaacaatgccaatatctatgagcagatcttccgctgc
ctgccatccaacgccacacgttccctgcgggcactccgggagtacgtggctgtggagccc
ctagccatggtcagccctcccttggcccggtctgagctcacccaggtccagggccacctg
gtccactttcccctcaagttcctggaggatgagtctttgttgccccccctgagtagcaag
gagggcatgatgcccatagaagtgtggacatag

KEGG   Miniopterus natalensis: 107529520
Entry
107529520         CDS       T05883                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04912  GnRH signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05200  Pathways in cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107529520 (PLD1)
   00565 Ether lipid metabolism
    107529520 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107529520 (PLD1)
   04072 Phospholipase D signaling pathway
    107529520 (PLD1)
   04071 Sphingolipid signaling pathway
    107529520 (PLD1)
   04024 cAMP signaling pathway
    107529520 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107529520 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107529520 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107529520 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    107529520 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107529520 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529520 (PLD1)
   05231 Choline metabolism in cancer
    107529520 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107529520 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529520 (PLD1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107529520 (PLD1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107529520 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    107529520 (PLD1)
SSDB
Motif
Pfam: PLDc PLDc_2 DUF3785 DUF5035
Other DBs
NCBI-GeneID: 107529520
NCBI-ProteinID: XP_016058462
LinkDB
Position
Unknown
AA seq 735 aa
MQQKEVDTGVKHCEDGGRSGNSEVLEAGKCKKMYSLPENSRRNRKWQIPSILQGNKLAPK
GHIKSIAEQKQEGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSTVY
LWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTTGPSLCSLPVETAES
MESLSLKDKKEPTKNLPALKSGDDMDSKLKGIGKASKLSKFSLYRQLHRHPLRGADSLSS
VDSASRYYNHCRSRQHLIHGLKPHLKLFRSSSGSEQGLFRSAMDTGSIRSLQTGVGELHG
ETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQ
RWNFTKIMKSKYRSLSYPFLLPKSHATAHELKYQVPGSIRANVQLLRSAADWSAGIKYHE
ESIHTAYVHVIENSKHYIYIENQFFISCADDKVVFNKIGDAIAQRILRAYRESQRYRVYV
VIPLLPGFEGDISTGGGNALQAIMHFNFRTMCRGENSILGQLKTELGNQWINYISFCGLR
THAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAIIVQDTETVPS
VMDGKEYEAGRFAQGLRLQCFRVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYD
KVFRCLPSDEVQTLIQLRDFITKPILAKEDPVRAEEELKKIRGFLVQFPFNFLSGEYLLP
SVGTKEAMVPMEVWT
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgcaacaaaaagaagtagatactggagtgaaacactgtgaagatggaggaaggtctgga
aattcggaggttttagaagctggaaaatgcaagaaaatgtattctctccctgaaaactcc
agaaggaatagaaagtggcagatcccaagcattcttcagggaaacaaactggctcccaaa
ggccacataaaaagtattgccgaacagaagcaagagggggtgaggatcttcataatgctc
tacaaggaggtggagctcgcactcggaatcaacagtgagtacagcaagaggactttaatg
cgcctgcaccccaacataaaggtgatgaggcacccagatcatgtgtcgtccaccgtatat
ttgtgggctcatcacgagaaacttgtcatcatcgaccagtcggtggcctttgtgggtggg
atcgacctggcctatggcaggtgggatgacaatgaacacagactcactgatgtgggcagc
gtgaagcgtgtcaccacgggaccgtctctgtgttccctcccagttgaaacagcagagtct
atggaatccttaagcctcaaagataagaaggaacctactaaaaatctgcccgcgctgaag
agcggcgatgatatggattcaaaactgaaaggcataggcaaagccagcaagctctccaaa
ttcagcctctacaggcagctccacaggcaccccctgcgcggcgcggacagcctcagcagc
gtcgacagcgcctcccgttattataatcactgtagaagtcgtcagcatttaatccatggt
ttaaagccccacttgaaactctttcgctcttccagtggttctgagcaggggctctttaga
tctgccatggacacgggctccatccgcagtttgcagacaggcgtgggagagctccacggg
gaaaccagattctggcatgggaaggactactgcaattttgtcttcaaagactgggttcag
ctggataaaccttttgctgatttcattgacaggtactccaccccccggatgccatggcat
gatattggctccgtggtccatgggaaggcggctcgtgacgtggcgcggcacttcatccag
cgctggaacttcacaaagattatgaaatcaaaatatcggtccctttcttatcctttcctg
cttccaaaatctcacgcaacagcccatgagttgaaatatcaagtgcctgggtccatccgc
gctaacgtacagttgctccgctctgctgctgactggtctgctgggataaagtaccatgaa
gagtccatccacactgcttacgtccacgtgatagagaacagcaagcactacatctatata
gaaaaccagtttttcataagctgcgctgatgacaaggttgtgttcaacaagatcggcgac
gccatcgcccagaggatactgcgagcttatagggaaagccagagataccgagtgtatgtt
gtgataccacttctgcccgggttcgaaggagacatttcaactggtggaggaaacgctctc
caggcaataatgcacttcaacttcaggaccatgtgcagaggagaaaattccatccttgga
caattaaaaacagagcttggcaatcagtggataaattacatatcattctgtggcctaaga
acacacgcagagcttgaaggaaacctagtcactgagctcatctatgttcacagcaagttg
ctaattgctgatgacaacactgttattattggctccgccaacataaacgaccgaagcatg
ttgggaaagcgcgacagtgaaatggcaatcattgtgcaggacaccgagacagtcccttca
gtgatggatggaaaagagtacgaagccggccgctttgcccagggacttcggctgcagtgc
ttcagggttgtccttggctatctttctgacccaagtgaggacattcaggatccagtgagt
gacaaattcttcaaggaggtgtgggtttcaacggcagctcgaaatgctacaatttatgac
aaggtgttccggtgccttcccagtgatgaagtgcaaaccttaattcagctcagagacttt
ataaccaagcccatattggcaaaggaggatcccgttagagccgaggaagaactgaaaaag
atccgtgggttcttggtgcagttcccctttaatttcttgtctggagaatacctactgcct
tctgttggaaccaaagaagccatggtgcctatggaggtttggacttaa

KEGG   Miniopterus natalensis: 107533526
Entry
107533526         CDS       T05883                                 

Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna00565  Ether lipid metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04024  cAMP signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04666  Fc gamma R-mediated phagocytosis
mna04724  Glutamatergic synapse
mna04912  GnRH signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna05200  Pathways in cancer
mna05212  Pancreatic cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107533526
   00565 Ether lipid metabolism
    107533526
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107533526
   04072 Phospholipase D signaling pathway
    107533526
   04071 Sphingolipid signaling pathway
    107533526
   04024 cAMP signaling pathway
    107533526
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107533526
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107533526
  09152 Endocrine system
   04912 GnRH signaling pathway
    107533526
   04928 Parathyroid hormone synthesis, secretion and action
    107533526
  09156 Nervous system
   04724 Glutamatergic synapse
    107533526
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533526
   05231 Choline metabolism in cancer
    107533526
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107533526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107533526
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     107533526
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107533526
 Endosome - Golgi transport
  Others
   Others
    107533526
SSDB
Motif
Pfam: PX PH
Other DBs
NCBI-GeneID: 107533526
NCBI-ProteinID: XP_016063731
LinkDB
Position
Unknown
AA seq 421 aa
MSLKTEPTVNISALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYKTQGFKEPNVQTYLSGCPIKAQVLEVERFTSTTRVGSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENTMKEEQFLGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSRRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWAGAMEEFIQKYGTNFLKDHRFGSYAALQENVLAKWYVNAKG
YFEDIANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAVCTFQINADVN
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtcactgaaaactgagccaacagtaaatatatctgcgctgcagaaaatcgctgctgac
atgagtaatttgatagaaaacctggacactcgggagctccacttcgagggagaggaggtg
gactacgatgtgtctcccagcgaccccaagatacaggaagtgtatatccctttctctgct
atttataagactcaaggatttaaggagcctaatgttcagacatacctctctggctgtcca
ataaaagcccaagttctggaagtggagcgctttacgtctacaacaagggtaggaagtatc
aatctttacactattgaattaacacatggggaatttaaatggcaagttaaaaggaaattc
aagcattttcaagaatttcacagagagctacttaagtacaaagcctttatccgaattccc
attcccaccagaagacacacatttagaagacagaatgtcaaagaagagcctcgagaaatg
ccaagcttaccacgttcctctgaaaacacgatgaaagaagaacagttccttggtaggagg
aaacaactggaagattacttgacaaagttactaaaaatgcccatgtatagaaactatcat
gcaacaacagaatttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggaatgataatgaaaaggtctggaggacacaggatacctggcttgaactgc
tgtggtcagggaagagcctgctaccggtggtcaagaaggtggctgatagtgaaagattcc
tttttgctgtatatgaaaccagacagtggagctattgccttcgtcctgctagtggataaa
gaattcagaattaaggtggggaagaaggagacagagacgaaatatggactccgaattgat
aacctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggca
ggcgctatggaagaattcatccagaaatatggcaccaactttctcaaagatcatcgattt
gggtcgtatgctgctctccaagagaacgttttagctaaatggtatgttaatgccaaagga
tattttgaagatattgcaaatgcgatggaagaggcaaacgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgccctgtggttgaaggaaatcgctggagg
ttggactgcattcttaaacgaaaagcagtatgtactttccaaataaatgctgatgtgaat
tcttaa

DBGET integrated database retrieval system