KEGG   Miniopterus natalensis: 107528114
Entry
107528114         CDS       T05883                                 

Definition
(RefSeq) aquaporin-2-like
  KO
K09865  aquaporin-2
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107528114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107528114
   04147 Exosome [BR:mna04147]
    107528114
Transporters [BR:mna02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107528114
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107528114
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107528114
NCBI-ProteinID: XP_016056522
LinkDB
Position
Unknown
AA seq 255 aa
MWELRSIAFSRAVFAEFLATLIFVFFGLGSALNWPRALPSVLEIAMAFGLAIGTLVQALG
HVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAINA
LNNNTTGGQAVTVELFLTLQLVLCIFASTDERRGDNLGTPALSIGLSVALGHLLGIHYTG
CSMNPARSLAPAVVTGKFDDHWVMHETSLLFLPSPRSPSQRGLEQSGVGAQQTLLGPGVP
PCGSAADRLSVPVCG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtgggaactccggtccatagccttctccagggccgtgtttgcagagttcctggccaca
ctcatttttgtcttctttggcctgggctcagccctcaactggcctcgggccctgccctct
gtgctggagatcgccatggccttcggcttggctattggcaccttggtgcaggccctgggc
cacgtcagcggcgcccacatcaaccctgcggtgactgtggcctgcctggtgggctgccac
gtctcctttctccgagctgccttctacgtggctgcccagctgctgggggccgtggcagga
gctgctctgctccatgagattacaccagcagacatccgaggggacctggctatcaatgca
ctcaacaacaacacaacaggtggccaggccgttactgtggagcttttcctgaccctgcag
ctggtgctctgcatctttgcctctacagatgagcgtcgtggagacaacctgggcacccct
gccctatccattggcttatctgtggccctgggtcacctccttgggatccactacactggc
tgctccatgaatcctgcccgctccctggctccagccgttgtcaccggcaaatttgatgat
cactgggtaatgcatgaaacctccctgcttttcctcccctcccccagaagcccttctcag
cgagggctggagcagagtggggtgggggcccagcaaaccctcctgggccccggggtccca
ccctgcgggtccgctgctgacagactcagtgtccccgtctgtgggtga

DBGET integrated database retrieval system