KEGG   Miniopterus natalensis: 107528210
Entry
107528210         CDS       T05883                                 

Gene name
ANO6
Definition
(RefSeq) anoctamin-6 isoform X1
  KO
K19500  anoctamin-6
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528210 (ANO6)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107528210 (ANO6)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 107528210
NCBI-ProteinID: XP_016056649
LinkDB
Position
Unknown
AA seq 909 aa
MWRPRGDVPASKRPFLRTHTLPSGLALENLDQMVVSSFGSLESQPDFRSPEFEEFNGKPD
SLYFNDGQRRIDFVLVYEDESRKENNKKGSNEKQRRKRRAYESNLIHDGLELEATRSVLD
DKLVFVKVHAPWEVLCTYAELMHIKLPLKPNDLKTRSSAFDNFNWFSKVLQVDESIIKPE
QEFFTAPFEKNRMNDFYIRDQDTFFNPATRSRIVYFILSRIKYQVSNNVKKFGINKLVSS
GIYKAAFPLHDCNFSYPSEDFSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIY
FAWLGYYTQMLLLAAIVGVACFLYGYMNRNNCTWSKEVCDPNIGGNIIMCPQCDKLCPFW
KLNITCESSQKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQP
RPEYEARCTHVVINEITQEEERVPFTTWGKCIRAVLCASAVLFWILLIIASVIGIIVYRL
SVFIVFSAKLPKNLNGTDPIQKYLTPQTATSITASLISFVIIMILNTIYEKVAIMITNFE
LPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPG
GCLLELTTQLTIIMGGKAIWNNIQEVLLPWVKNLIGRCRTVSGSEKISPRWEQDYHLQLM
GRLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKMTTQYRRMVPEKA
QDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGNHTHYTMDGYINN
TLSYFNIADFKNRSKGNPYSGLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFI
IVMEHVIYSVKFFLSYAIPDVSKSTKSKIKREKYLTQKLLHENHLKDMTKNLAEHMIGVV
DNHLRPKLE
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgtggaggcccagaggtgacgttcccgcctccaagaggccttttctgagaactcacacc
ctcccctccggtctggcgttggaaaacctcgatcagatggttgtctccagttttggaagt
ctggaaagtcagcctgatttccggtccccagagttcgaagaatttaacgggaaacctgac
tcactctattttaatgatggccagcgaagaatcgacttcgtcctggtgtatgaagatgag
agcaggaaagagaacaataaaaagggttcaaacgaaaagcagaggagaaaaagacgggcc
tatgaatcgaacctcatccatgatggcctggagctagaagcaacgagatcggttttggat
gacaagctagtatttgtaaaggtacatgccccgtgggaggtgttatgtacatatgcggag
ttaatgcacatcaaattgcctctgaaacccaatgatctgaaaacccggtcttcagccttc
gataatttcaactggtttagcaaagtcctccaagtggatgaaagtatcatcaagccagag
caggagtttttcaccgctccatttgagaagaaccgaatgaatgatttttatattcgtgat
caagataccttctttaatccagccaccagaagccgcattgtttacttcattctctcccga
atcaagtatcaagtgagcaacaatgttaaaaagtttggaattaacaaacttgtaagctct
gggatctacaaggcagctttccctcttcatgattgcaacttcagctatccatcggaggat
ttcagctgcccgaatgaacggtacctgctgtacagagaatgggctcatcctcgaagcata
tacaaaaagcagcccttggatctcatcaggaaatattatggagagaagatcggaatctat
tttgcctggctgggctattacactcagatgctcctcctggcagcaatagtgggcgtggcg
tgctttctctacggatacatgaatcgaaataactgcacatggagcaaagaagtttgtgat
cctaatattggcggcaacatcataatgtgtcctcagtgtgataagctttgtccattctgg
aaactcaatattacttgcgagtcctcacagaaattgtgcatctttgacagctttggaacc
ctagtctttgcagtatttatgggggtatgggttaccttgtttttggagttttggaagcgg
cgccaggcggaacttgagtatgaatgggacactgttgagttacagcaggaagaacagccc
cggcccgaatatgaggcacgatgtactcacgtggtgatcaatgagattactcaggaagaa
gagcgtgttccctttactacctgggggaaatgcatacgtgccgtcctctgtgcgagtgct
gtcttattctggatcctacttatcattgcttcagttattgggatcattgtctacagactc
tcagtgttcattgtattttctgcaaaacttcccaagaacttgaatggaacagacccgatc
cagaagtatctgaccccacagacggccacgtccatcaccgcttccctcatcagcttcgtc
atcatcatgattctgaacaccatctatgagaaagtggcaatcatgattactaattttgaa
ctcccaaggacccagactgactatgagaacagcctaaccatgaagatgttcttattccag
ttcgtcaactactactcttcatgtttctacatcgcattcttcaagggcaaatttgtcggt
tatcccggagacccagtgtattggctgggaaaatacagaaatgaagagtgtgacccaggc
ggctgtctccttgaactgacaacacaactgacaataatcatgggaggaaaagcaatctgg
aataacatacaagaggtgttacttccctgggtcaagaatctaatcggacgctgtcgcaca
gtttcgggctcagaaaagatatccccgcgatgggaacaggactaccatctgcagctcatg
ggcaggctgggattattttatgaatatcttgaaatgattattcagtttggctttgtcacc
ttatttgtggcctcttttccactggcccctctgctggctctggtgaacaatatattggaa
ataagggtggacgcgtggaaaatgactacgcagtatagacgcatggtgccagaaaaagcc
caggacattggagcgtggcagcccatcatgcaaggaatcgccatcctggctgtggtgacc
aatgccatgattattgctttcacatcagacatgatcccccgcctggtgtattactggtcc
ttctctgtccctccatatgggaaccacacccactacaccatggacggatacatcaacaat
actctctcctacttcaacatcgccgacttcaaaaacaggagcaagggaaatccatactcc
gggcttggtaaccataccacgtgcaggtaccgtgatttccggtaccctcctggacaccca
caggagtataaacacaacatctactactggcacgtgatcgcggccaagctggcttttatc
atcgtcatggagcacgtcatctactccgtgaagttttttctgtcatacgcaattccggac
gtatcgaaaagcacaaagagcaagattaagagagaaaaatacctaacccagaagcttctc
catgagaatcacctcaaagatatgaccaaaaacctggctgagcacatgataggggtggta
gataaccacttacggcccaaattagagtaa

DBGET integrated database retrieval system