KEGG   Miniopterus natalensis: 107528214
Entry
107528214         CDS       T05883                                 

Gene name
SLC38A1
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 1
  KO
K14990  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04724  Glutamatergic synapse
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107528214 (SLC38A1)
   04727 GABAergic synapse
    107528214 (SLC38A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107528214 (SLC38A1)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107528214 (SLC38A1)
SSDB
Motif
Pfam: Aa_trans Cation_ATPase_C NADH-u_ox-rdase
Other DBs
NCBI-GeneID: 107528214
NCBI-ProteinID: XP_016056658
LinkDB
Position
Unknown
AA seq 490 aa
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLILLSSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVKEQGINSTIISDNSTNTGMCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYS
ELKDRSQKRMQMVSNISFFAMFVMYFLTAIFGYFTFYENVSSDLLHKYQSKDDILVLTVR
LAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHIFVTIILLVIVNLLVIFIPSMKDI
FGVVGVTSANMLIFILPSSLYLKLTNQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDW
ACSPGNDEGH
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgatgcatttcaaaagtggacttgaattgactgagttgcaaaacatgacagtccccgaa
gatgacaacatcagcaatgattccaatgacttcactgaagtagaaaatggtcaaataaat
agcaaatttatttctgatcgtgaaagtagaagaagtctcacaaacagccatttggaaaaa
aagaaatgtgatgaatatattccaggaacaacctccttaggcatgtctgtttttaaccta
agcaacgccattatgggcagtgggattttgggactcgcctttgccctggcaaacactggg
atcctactttttctgatacttttgtcttcagtgacactgctgtctatatattccataaac
cttctgttgatctgctcaaaggaaacaggctgcatggtttatgaaaagctgggagaacag
gtctttggcaccacggggaagtttgtaatctttggagccacctctctccagaacaccgga
gcaatgctgagctacctcttcatagtaaaaaatgagctgccctctgccataaagtttcta
atgggaaaggaagagacattttcagcctggtatgtggacggccgtgttctggtggtgata
gttacctttggcataatcctccctctatgtctcttgaagaatttagggtatcttggctat
actagtggattttccttgagctgtatggtttttttcctaatagtggttatctacaagaaa
tttcaaattccctgcattgttaaagagcagggaataaattcaacaataataagtgataat
tcaacaaatactggcatgtgtacgccaaaatatgttaccttcaattcaaagacggtgtat
gctctaccaaccattgcatttgcatttgtctgccatccatcagtcctgccaatttacagt
gagcttaaagatcgatcacagaaaagaatgcagatggtttcaaatatctccttttttgcc
atgtttgttatgtacttcttgactgccatttttggctactttacattctatgaaaacgtg
agttcagacctccttcacaagtaccagagcaaagacgacattctagtcctgacggtacgg
ctggctgtcatcgttgctgtcatcctcacggtgccagtgttatttttcacggttcgttca
tctttatttgaactggctaagaaaacaaagtttaatctatgtcgtcacatctttgttacc
ataatactcttggtcattgttaacttgttggtgatcttcataccctccatgaaggatatt
tttggagtcgtaggagttacatctgctaatatgcttattttcattcttccttcatctctt
tatttaaaactcacgaaccaggatggagataaaggaactcaaagaatttgggctgccctt
ttcttgggcctgggggtattgttctccctggtcagcattcccttggtcatctacgactgg
gcctgctcaccggggaatgacgaaggccactga

KEGG   Miniopterus natalensis: 107528216
Entry
107528216         CDS       T05883                                 

Gene name
SLC38A2
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 2 isoform X1
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04724  Glutamatergic synapse
mna04727  GABAergic synapse
mna04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    107528216 (SLC38A2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107528216 (SLC38A2)
   04727 GABAergic synapse
    107528216 (SLC38A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107528216 (SLC38A2)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107528216 (SLC38A2)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 107528216
NCBI-ProteinID: XP_016056669
LinkDB
Position
Unknown
AA seq 505 aa
MKKAEVGRFNISPDEDSSSYSSNSDFNYSYPTKQAALKSHYVDVDPENQNFLLESNLGKK
KYETDFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGQKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIKAL
LNIEDTTGLWYLNGDYLVLLVSLVLILPLSLLRNLGYLGYTSGFSLLCMLFFLIVVICKK
FEIACPFEDYSLISEAVNMTFIQPTALVPHMAFNMTDDSCRPHYFTFNSQTVYAVPILTF
SFVCHPAILPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYENVESELLHT
YSNVMGADILLLIVRLAVLVAVTLTVPVVIFPIRGSITHLFCSTKDFSWWRHSLITISIL
AFTNLLVIFVPTIRDIFGFIGASAAAMLIFILPSAFYIKLVKKETMKSVQKIGALLFLLS
GVVVMIGSMALIILDWVHNAKEGGH
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaagaaagccgaagtgggaaggttcaacatttccccggatgaggacagcagcagctac
agttccaacagtgacttcaactactcctaccccaccaagcaagctgctctgaaaagccat
tatgtagatgtagatcctgaaaaccagaactttttacttgaatcgaatttggggaaaaag
aagtatgaaacagacttccatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacatttgtgtcaatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggagggtctttattatacgaacaattgggacaaaaa
gcatttggattggttggaaagcttgcagcctctggatcaattacaatgcagaacattgga
gctatgtcaagctacctcttcatagtgaaatatgagttacctttggtgatcaaggcatta
ctgaacattgaagatacaactggactgtggtatctgaacggcgactatttggtcctgctg
gtgtcattggtgctcattcttcctttgtcactgctgagaaatttaggatatttgggatat
accagtggcttttccttgttatgtatgctgttctttctgattgtggtgatttgcaagaaa
tttgagattgcttgtccttttgaagattattcattgattagtgaggcagtgaatatgacc
ttcatacagccaacagctttagtacctcatatggcatttaacatgactgatgattcttgc
agaccacattattttaccttcaactcacagaccgtctatgctgtgccaattctgaccttt
tcatttgtctgtcatcctgctattcttcccatttatgaagagctgaaagaccgcagccgt
aggagaatgatgaatgtatccaagatttcattttttgctatgtttctcatgtacctgctt
gctgccctcttcggatacttgacattttatgaaaacgttgagtcagaattgcttcacacc
tactctaatgtcatgggagctgatatcctccttctcattgtccgtttggctgtgttagtg
gccgtcaccctgacagttccagtcgttattttcccaatccggggttccataactcactta
ttttgctcaacaaaagatttcagctggtggcgtcatagtctcattacaatatccatcttg
gcatttaccaatttgcttgtcatttttgtcccgactattagagatatctttggtttcatt
ggtgcatctgcagctgctatgttgatttttattcttccatctgccttctatatcaagtta
gttaagaaagaaactatgaaatctgtacaaaagattggggctttgctcttcctgttaagt
ggtgtagtggtgatgatcggaagcatggccttgattattctggattgggtacacaatgcc
aaggaaggtggccattaa

DBGET integrated database retrieval system