KEGG   Miniopterus natalensis: 107528219
Entry
107528219         CDS       T05883                                 

Gene name
RAPGEF3
Definition
(RefSeq) rap guanine nucleotide exchange factor 3
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04670  Leukocyte transendothelial migration
mna04720  Long-term potentiation
mna04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107528219 (RAPGEF3)
   04072 Phospholipase D signaling pathway
    107528219 (RAPGEF3)
   04024 cAMP signaling pathway
    107528219 (RAPGEF3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107528219 (RAPGEF3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107528219 (RAPGEF3)
  09156 Nervous system
   04726 Serotonergic synapse
    107528219 (RAPGEF3)
   04720 Long-term potentiation
    107528219 (RAPGEF3)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 107528219
NCBI-ProteinID: XP_016056674
LinkDB
Position
Unknown
AA seq 923 aa
MKVGWPGESRWQVGLIVEYSSALGAPQVGGLPDLVPEATLLNMVLRRMHRPRSYSYQLLL
EHQRPSRIQGLRWTPLTNSEESLDFSVSLEQASTERVLRAGRQLHRHLLATCQNLIRDRK
YHLRLYRQCCSGRELVDGILTLGLGVHSRSQAVGICQVLLDEGALCHVKHDWTFQDRDTQ
FYRFPGPEPEPAGVHELEEELVEALALLSQRGPDALLTVALRKPPGQRTDEELELIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTIRLEEHG
KVVLVLERTSQGAGSSCPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSD
FLLTHRVFMPSTQLCAALLHHFHAEPTGGSEQERNTYICNKRQQILRLVSQWVALYGPML
HTDPVASSFLQKLSDLVSRDARLSNLLREQWPERRRHHRLENGCGNTSPQIKARNMPVWL
PGQDEPLPSSNCAIRVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELTPHPEQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWNLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAVRMLHHCRSHSNVPLSPLRSRVSHLHEDGQAARISTCSEQSLSTRSPASTWA
YVQQLKVINNQRELSRLSRELEP
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgaaggtgggctggccaggtgagagccgctggcaggtgggcctgattgtggagtacagc
tcagccctgggagcaccacaggtgggcggccttccagacctggtgccggaggcgacgctg
ctcaacatggtgctgaggaggatgcaccggccccgaagctactcctaccagctgctgctt
gagcaccagcgccccagccgcatccaggggcttcgctggacgccactcaccaacagcgag
gagtccctggatttcagtgtgagcctggagcaggcgtccacagagagggtgctcagggct
gggaggcaactgcatcggcatctcctggccacctgccagaacctcatccgagaccgaaag
taccaccttaggctctatcggcaatgctgctcaggccgggagctggtggatgggatcttg
accttggggcttggggtccattcacggagccaagctgtgggaatctgccaagtcctgcta
gatgaaggtgccctctgccatgtgaaacatgactggaccttccaggaccgagacacccaa
ttctaccggttcccggggccagagccggagcctgcgggagtccatgagctggaggaggag
ctggttgaggccttggccctgctctcccagagagggcctgatgccctgctcactgtggca
cttcgaaagccccctgggcagcgcacagacgaggagctggagctcatctttgaggagctg
ctgcacatcaaggctgtggcccacctctccaactcggtgaagcgagaattagcagcagtt
ctgctctttgaaccacacagcaaggcggggactgtgctgttcagccagggggacaagggc
acctcgtggtacattatctggaagggatccgtcaatgtggtgacccatggcaaggggctg
gtgaccacactgcatgagggagacgactttgggcagctggctctggtgaatgatgcgccc
cgggcggccaccatcatcctgcgagaggataactgtcattttctccgcgtggacaaacag
gacttcaaccgtatcatcaaggatgtggaagcaaagaccataaggctggaagaacatggc
aaagtggtgttggtgctggagagaacctcccagggcgctggctcttcttgccctccaacc
ccaggcaggaaccggtatacggtgatgtctggcaccccggagaagatccttgaactgctg
ttggaggccatgaggcctgattccagtgctcatgatccaacagagacattcctcagtgac
ttcctcctgacccacagagtcttcatgcccagcacccagctctgcgctgccctcctgcac
cacttccacgcggagcccactggaggcagtgagcaggagcgcaacacctacatctgcaac
aagagacagcagatcctgcggctggtcagccagtgggtggccctgtatggccccatgctc
cacactgaccctgtggccagcagctttctccagaaactctcagacctggtgagcagggat
gctcggcttagcaacctgctgcgggaacagtggccggagaggcggcggcaccacaggttg
gaaaatggctgtggaaacacatctcctcagataaaggctcggaacatgcctgtttggctc
cccggccaggacgagcccctccccagcagcaactgtgccatccgagttggggacaaagtc
ccctatgacatctgccggccggaccactcggtgctaaccctgcagctgcctgtgacagct
tcagtgagagaggtgatggcagcgttggcccaggaggatggctggaccaagggacaggtg
ttggtgaaggtcaactctgcgggtgatgccattggcctgcagccagatgcccgtggtgtg
gccacatccctggggctcaacgagcggctctttgttgtcaacccacaggaagtgcatgag
ctgactccacaccctgagcagctggggcccacggtgggttctgctgaggggctggacctg
gtgagcgccaaggacctggcaggccagctgacggaccatgactggaacctcttcaacagt
attcaccaggtggaactgatccactacgtgctgggcccccagcacctgcgcgatgtcacc
accgccaatttggagcgcttcatgcgtcgcttcaatgagctgcagtactgggtggccaca
gagctgtgtctctgcccagtgcctggccctcgggcacagctgctcaggaagttcattaag
ctggcagcccacctgaaggaacaaaagaacctcaactccttctttgctgtcatgtttggc
ctcagcaactcagccatcagccgcctggctcacacctgggagcggctgccccacaaagtc
cggaagctgtactcggcccttgagaggctgctggatccctcatggaaccaccgagtgtat
cgactggccctgaccaagctctcccctcctgtcatccccttcatgcctcttcttctcaaa
gacatgacctttatccacgagggaaaccacaccctggtggagaatctcatcaactttgag
aagatgaggatgatggccagagccgtgcggatgctgcaccactgccgaagccacagcaac
gtgcctctctcaccactccgaagccgcgtctcccacctccacgaggacggccaagcagcg
aggatttctacatgctcggagcagtccctgagcacccgaagtccagccagcacctgggct
tatgtccagcagctgaaggtcatcaacaaccagcgggaactgtcccgcctctcccgggaa
ctggagccttga

KEGG   Miniopterus natalensis: 107531114
Entry
107531114         CDS       T05883                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4 isoform X1
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04670  Leukocyte transendothelial migration
mna04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107531114 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    107531114 (RAPGEF4)
   04024 cAMP signaling pathway
    107531114 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107531114 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    107531114 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107531114 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107531114 (RAPGEF4)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107531114 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF DEP cNMP_binding RasGEF_N
Other DBs
NCBI-GeneID: 107531114
NCBI-ProteinID: XP_016060619
LinkDB
Position
Unknown
AA seq 867 aa
MPYKKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPPIEPHVPPRPANTIPKVPSEKIL
RAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMLQQTPCVHSRTQAVGMWQV
LVEDGVLNHVDQEHHFQDKYLFYRFLDDDHEDAPLPTEEEKKECDEELQDTMLLLSQMGP
DAHMRMILRKSPGQRNMDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVL
FNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCH
FLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGSRASNQGNSQPQQKYTVMSGT
PEKILEHFLETIRLEPALNEATDSFLNDFVMMHCVFMPNTQLCPALMAHYHAQPSQGTEQ
EKVDYALNNKRRVVRLVLQWASAYGDLLQEDSVAMAFLEEFYVSVSDDARMIAALKEQLP
ELERIVKQISEDAKNPQKKHKVLLQHFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTI
RVPVAASVKEVISAVADKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACP
REQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHTFGRH
NFKKTTANLDLFLRRFNEIQFWVITEICLCSQPSKRVQLLKKFIKIAAHCKEYKNLNSFF
AIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFM
PLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARMVRYCRSQPFNLDAAQANKNHQDVR
SYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgccctacaagaaatatcgacagtacatggcaggacttctggctcctccttatggtgtt
atggaaacgggctctaacaatgacaggattcctgacaaggagaatacacctcccattgaa
cctcacgtccctcctcgtcctgctaacaccattcccaaggttccttcagagaagatcctc
agggctggaaaaattttacgaaatgccattctctctcgggcacctcacatgataagagat
agaaagtatcacctaaagacatacagacaatgctgtgtgggcaccgagctggtggactgg
atgctgcagcagactccgtgtgttcactcccgaactcaagctgtcggcatgtggcaggtc
ctggtggaagatggtgttctcaaccacgtggaccaggagcatcatttccaagacaaatat
ttattttatcgctttctggacgatgaccacgaggacgcccctctgccgactgaggaggag
aagaaggagtgtgatgaggaactgcaggacaccatgctgctgctgtcacagatgggcccg
gacgcccacatgaggatgatcctccgcaaatcacctggccagaggaatatggatgacctg
gagattatctatgatgagctccttcacatcaaagccttatcccacctttccaccaccgtg
aaacgggagttagcaggcgttctcatttttgagtctcatgccaaaggaggcaccgtgttg
tttaaccagggggaagaaggtacctcctggtacattattctaaaaggatcagtgaatgta
gtcatttacggcaagggtgtggtctgtaccctgcatgaaggagatgattttggcaagttg
gcactagtgaacgatgctccgagagctgcttctatcgtcttgcgagaagataattgccat
ttcttaagagtagacaaggaggatttcaaccggattctgagggacgttgaggcgaataca
gtcagactgaaagaacatgaccaagatgtcttggtgctggagaaggtcccagcagggagc
agggcttctaatcaaggaaactcacagcctcagcaaaagtatactgtgatgtcaggaaca
cctgaaaaaattttagagcattttctagaaacaatacgccttgagccagctttaaatgaa
gcaacagactcctttttaaatgactttgttatgatgcactgtgtttttatgccaaatacc
cagctttgcccagccctgatggcccattaccacgcacagccttcgcaaggtacggagcag
gagaaagtggattatgccctcaacaacaagaggcgagtcgtccgcctggttctgcagtgg
gcctcggcctatggggacctcctacaagaagatagcgtggccatggctttcctggaggag
ttttatgtatctgtgtcagatgatgcccggatgatcgccgccctcaaggagcaactgccc
gagttggagaggattgtcaagcaaatttcagaagatgcaaagaatccacaaaagaagcac
aaagttcttttgcaacatttcaacacaggtgatgagagagcccagaagcgtcagcctatc
cgtggctctgatgaagttctgttcaaggtctattgcatggaccacacctacacaaccatt
cgggtgccggtggccgcctcagtgaaggaagtcatcagtgcagttgcggacaagctgggc
tctggggaaggcctgatcatagtcaagatgagctccggaggagaaaaggtggtgctcaaa
cctaatgatgtttccgtgtttacgacgctcaccattaacggacgcctgttcgcttgcccg
cgagagcagttcgattcactgactcccttgccagaacaggaaggcccaactgtcggaaca
gtgggaacttttgaactgatgagctcgaaagatttagcataccagatgacaatttatgat
tgggaactcttcaactgcgtgcatgagctggagctaatctaccacacatttggaaggcat
aattttaaaaagaccacagcaaacttggatttgttcctgagaagatttaatgaaattcag
ttttgggtcatcactgagatttgcctttgttcccagcccagcaagcgtgttcagctctta
aaaaaatttattaagatagcagctcactgtaaggagtacaaaaatctgaattcctttttt
gccatcgtcatggggctaagtaacgttgccgtgagccgcttggcactgacgtgggagaaa
ctgccaagcaagtttaagaagttctatgcggagtttgaaagtttaatggatccttcaagg
aaccacagggcctacaggctgacagtagctaagctggagcctcctctcatccccttcatg
cctttgctcatcaaagatatgacatttactcatgaggggaacaagactttcattgacaat
ctagtcaactttgaaaaaatgcgcatgattgcaaatactgccaggatggtgagatactgc
agaagccaacctttcaatcttgacgcagctcaagctaataagaaccatcaggatgtccgg
agttacgtccggcaattaaacgtgattgacaaccagagaactttatcacagatgtcacac
cgattagagcctcgtcgaccatag

DBGET integrated database retrieval system