KEGG   Miniopterus natalensis: 107528232
Entry
107528232         CDS       T05883                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04114  Oocyte meiosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04727  GABAergic synapse
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05032  Morphine addiction
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107528232 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107528232 (ADCY6)
   04371 Apelin signaling pathway
    107528232 (ADCY6)
   04072 Phospholipase D signaling pathway
    107528232 (ADCY6)
   04024 cAMP signaling pathway
    107528232 (ADCY6)
   04022 cGMP-PKG signaling pathway
    107528232 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107528232 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107528232 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107528232 (ADCY6)
   04062 Chemokine signaling pathway
    107528232 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    107528232 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    107528232 (ADCY6)
   04912 GnRH signaling pathway
    107528232 (ADCY6)
   04913 Ovarian steroidogenesis
    107528232 (ADCY6)
   04915 Estrogen signaling pathway
    107528232 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    107528232 (ADCY6)
   04921 Oxytocin signaling pathway
    107528232 (ADCY6)
   04926 Relaxin signaling pathway
    107528232 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    107528232 (ADCY6)
   04918 Thyroid hormone synthesis
    107528232 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    107528232 (ADCY6)
   04916 Melanogenesis
    107528232 (ADCY6)
   04924 Renin secretion
    107528232 (ADCY6)
   04925 Aldosterone synthesis and secretion
    107528232 (ADCY6)
   04927 Cortisol synthesis and secretion
    107528232 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107528232 (ADCY6)
   04270 Vascular smooth muscle contraction
    107528232 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    107528232 (ADCY6)
   04971 Gastric acid secretion
    107528232 (ADCY6)
   04972 Pancreatic secretion
    107528232 (ADCY6)
   04976 Bile secretion
    107528232 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107528232 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107528232 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    107528232 (ADCY6)
   04727 GABAergic synapse
    107528232 (ADCY6)
   04725 Cholinergic synapse
    107528232 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    107528232 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    107528232 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    107528232 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    107528232 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    107528232 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107528232 (ADCY6)
   04714 Thermogenesis
    107528232 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528232 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    107528232 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107528232 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528232 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528232 (ADCY6)
   05163 Human cytomegalovirus infection
    107528232 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107528232 (ADCY6)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107528232 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 107528232
NCBI-ProteinID: XP_016056698
LinkDB
Position
Unknown
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRHRTRTSGFCAPRYMSCLQDAQPPSPSPTAPP
RCPWQEEAFIRRGGPGKGTELGLRAVALGFEDTETTAAVGVAEVAPDVAPRNRRSCWRRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVA
LLACAAILFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHMILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGHGGERNAYL
KEQHIETFLILGTSQKRKEEKAMLAKLQRTRANSVEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
QKVDPRFGAYVACALLVFCFICFIQLLVFPHSMLMFGIYAGIFLLLLITVLTCAVYSCGS
LCPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHINSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFSGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggccttctggtccccaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgccctcgtcacaggactcgcaccagtggcttctgtgcgccc
cgatatatgagctgcctccaggatgcacagccacccagccccagccctacagctccacct
cggtgcccctggcaggaggaggccttcatccggaggggtggcccaggcaagggcactgag
ctggggctgcgggcagtggccctgggctttgaggacactgagacaacagcagcggttggg
gtggctgaggtggcacccgatgtagcacccaggaacaggcgatcctgctggcgccggctg
gtgcaggtgttccagtcgaagcagttccgctcagccaagctggagcgcctgtaccagcgg
tacttcttccagatgaaccagagcagcctcacgctgctgatggcggtgctcgtgctgctc
acagctgtgctgctggccttccatgctgcgcccgcccgccctcagcctgcctacgtggcc
ctgctggcctgtgcagccatcctcttcgtggtgctcatggtggtgtgcaaccggcatagt
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcagctgtg
caggttgggggtgccctggcagccaacccccatagcccatcagtaggcctttggtgccct
gtgttctttgtctacatcacctacacgctcctacccatccgcatgcgggcagctgtcttc
agtggcctgggcctctccaccctacatatgatcttggcctggcaactcaaccgtggtgat
gccttcctctggaagcagcttggtgccaacatgctgctgttcctctgtaccaacgttatt
ggcatctgcacacactacccagctgaggtgtctcagcgccaggcctttcaagagactcgt
ggctacatccaagcccggctgcacctgcagcatgagaatcggcagcaggagcggctactg
ctgtcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgttt
gcagacatcgaaggttttaccagcctggcatcccagtgcaccgcacaggagctggtcatg
accctgaatgagctctttgcccggtttgacaagttggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcaggattgcctgaggcccgggcagac
catgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgt
gaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccatagcgggcgcgtgcactgc
ggtgtccttggcctgcggaaatggcaattcgatgtgtggtccaatgacgtgactctggcc
aaccacatggaggcggggggccgggccggccgcatccacatcactcgggccacgctgcag
tacctgaatggggactacgaggtggagcctggccatggtggtgagcgcaatgcatacctc
aaggagcagcacattgagaccttcctcatcctgggcaccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcggacgcgggccaactctgtggaagggctgatgcca
cgctgggtgcctgaccgagccttctcccggaccaaggactccaaggctttccgccagatg
ggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccctgaggat
gaggtagatgagttcctgggccgtgccattgatgcccgtagcatcgatcagctgcgcaag
gaccacgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactca
cagaaagtggatccccgtttcggagcctacgtggcctgtgccctgttggtcttctgcttc
atctgcttcatccagcttctcgtcttcccacactcaatgctgatgtttgggatctatgcc
gggatcttcctactgctgctgatcactgtgctgacttgcgcggtgtactcctgtggctct
ctttgccctaaggccctgcaacgcctgtcgcgcagcattgtacgctcgcgggcacacagc
actgcagttggcatcttttcggtcctgcttgtgttcacctccgccatcgccaacatgttc
acctgtaaccacacccccatacggacctgtgcagcccggatgctgaatttaacacctgct
gacatcaccgcctgccacctgcagcagctcaattattctctgggccttgatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtactttgtcgggaacatgctgctg
agtctgttggcgagctctgtcttcctgcacatcaatagcatcgggaagttggccatgatc
tttgtcctggggctcatctatttggtgctgcttctactgggccccccagccactatcttt
gacaactatgatctgctgcttggagtccatggcttggcttcttccaatgagaccttcagt
gggctggactgcccagctgcagggagggtggcactcaaatacatgacccccgtgattctg
ctggtgtttgcgctggcactgtatctgcatgctcagcaggtggaatcgactgcccgcctg
gacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctccaggca
tacaaccggcgtctgctgcataacatcctgcccaaggatgtggccgcccactttctggcc
cgggagcgccggaatgatgagctgtactatcagtcttgtgagtgtgtggctgtcatgttt
gcctccattgccaacttctctgagttctacgtggagctggaggcaaacaatgagggtgtc
gagtgccttcggctgctcaatgagatcatcgctgactttgatgagatcatcagtgaggag
aggttccggcagctggagaagatcaagacgattggtagcacctacatggctgcctctggg
ctgaacgccagcacctatgatcaggtgggccgctcccacatcactgccctcgctgactac
gctatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagattggactgaacatgggccctgtggtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaatacagtgaatgtctctagccggatggacagcacaggggtt
cctgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Miniopterus natalensis: 107534062
Entry
107534062         CDS       T05883                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04114  Oocyte meiosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04727  GABAergic synapse
mna04740  Olfactory transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05032  Morphine addiction
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107534062 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107534062 (ADCY3)
   04371 Apelin signaling pathway
    107534062 (ADCY3)
   04020 Calcium signaling pathway
    107534062 (ADCY3)
   04072 Phospholipase D signaling pathway
    107534062 (ADCY3)
   04024 cAMP signaling pathway
    107534062 (ADCY3)
   04022 cGMP-PKG signaling pathway
    107534062 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107534062 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107534062 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107534062 (ADCY3)
   04062 Chemokine signaling pathway
    107534062 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    107534062 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    107534062 (ADCY3)
   04912 GnRH signaling pathway
    107534062 (ADCY3)
   04913 Ovarian steroidogenesis
    107534062 (ADCY3)
   04915 Estrogen signaling pathway
    107534062 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107534062 (ADCY3)
   04921 Oxytocin signaling pathway
    107534062 (ADCY3)
   04926 Relaxin signaling pathway
    107534062 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    107534062 (ADCY3)
   04918 Thyroid hormone synthesis
    107534062 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    107534062 (ADCY3)
   04916 Melanogenesis
    107534062 (ADCY3)
   04925 Aldosterone synthesis and secretion
    107534062 (ADCY3)
   04927 Cortisol synthesis and secretion
    107534062 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107534062 (ADCY3)
   04270 Vascular smooth muscle contraction
    107534062 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    107534062 (ADCY3)
   04971 Gastric acid secretion
    107534062 (ADCY3)
   04972 Pancreatic secretion
    107534062 (ADCY3)
   04976 Bile secretion
    107534062 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107534062 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107534062 (ADCY3)
   04727 GABAergic synapse
    107534062 (ADCY3)
   04725 Cholinergic synapse
    107534062 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    107534062 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    107534062 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    107534062 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    107534062 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    107534062 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107534062 (ADCY3)
   04714 Thermogenesis
    107534062 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534062 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    107534062 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107534062 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107534062 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107534062 (ADCY3)
   05163 Human cytomegalovirus infection
    107534062 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107534062 (ADCY3)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107534062 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 107534062
NCBI-ProteinID: XP_016064486
LinkDB
Position
Unknown
AA seq 1145 aa
MPRNQGFSDPEHSAEYSAEYSASLPSDPDRGMGRTHEISVRNWGSCLCLPSFMRLTFVPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYALAMCAVVFSRDKLAPLVVAGVGLVLDIL
LYVLCKKGLLPGRVTRKVVPYLLWLLITAQIFSYLSLNFAGLHAAGDTAGWQAFFVFSLF
ITLPLGLGPILLLSVASCVVHTLILGVTVAQQQQDRLKGMQLLREILANIFLSLCAITVG
IMSYHMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSTCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLRGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKPSSPALIETKEPNGSVHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKERNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCSALVEILIDPWLMTN
YVTFVIGELLLLVLTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYSMGPNNGTAGIETEGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWCPIFDEYDRRRFQEHDFPVVALEKMQILSTTGLNGTDRLPLVPSK
YTMTVMIFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSEKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaatcagggcttctccgatcccgagcactcggctgagtactctgccgagtac
tcggccagcctgccctccgaccccgaccgcggcatgggccggacgcacgagatctcggtg
cggaactgggggtcctgcctctgcctgcccagcttcatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttccggaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagcgctcttcgactgctacgcgctggccatgtgcgccgtggtcttc
agccgcgacaagctggcgcccctcgtggtggccggggtcgggctggtgttggacatcctc
ctctacgtgctctgcaaaaaggggctgctccccgggcgcgtcacccggaaagtggtgccc
tacctgctgtggctgctcattacagcccagatcttctcctacctgagcctgaacttcgcg
ggcctgcatgcggccggcgacacggcgggctggcaggccttcttcgtcttctccctcttc
atcacgctgcccctgggcctcggccccatcctcctcctctccgtggcttcctgtgttgtg
cacacgctgattttgggggtcacggtggcccagcagcagcaggacaggctgaaggggatg
cagttgctgagagagatcctggccaacatcttcctctccctgtgcgccatcaccgtgggc
atcatgtcctaccacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctg
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctcttcgcagacatcgtgggcttcacccagctgtcttctacctgcagcgcccaggagctc
gtgaagctgctcaatgagctcttcgcccgcttcgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gttcgggagaagacaaagaccggggtggacatgcgtgtgggggtgcacacgggcacggtg
ctggggggtgtcctgggccagaagcgctggcagtatgatgtgtggtctactgacgtcact
gtggccaacaagatggaggctggcggcatccccgggcgcgtgcacatctcccagagcacc
ctggactgcctgagaggagagttcgacgtggagcccggtgacgggggcagccgctgtgat
tacctagaggagaagggcatcgaaacctacctcatcattgcgtccaagccggaggtgaag
aaaactgccacccaaaatggcctcaacggctcggctctgccaaacggagcgccagcatcc
tcaaagcccagctcccctgccctcatcgagaccaaggagcccaatgggagtgtccacacc
agtggctccacgtcagaggagcccgaggagcaggatgcccaggctgacaacccctccttc
cccaaccctcgccggaggctgcggcttcaggacctggctgaccgagtggtggacgcctct
gaggacgagcacgagctcaaccagctgctcaacgaggccctgctcgagcgggagtcggcc
caggtagtgaaggagaggaacaccttcctcctgtccatgcggttcatggaccccgagatg
gagacccgctactcggtggagaaggaaaagcagagcggggccgccttcagctgctcctgc
gtcgtcctgctctgcagcgccttggtggagattctcatcgacccctggctaatgacaaac
tacgtgacgtttgtgattggggaacttctgctactggtcctgacgatctgttcactggct
gccatctttccccgggcctttcctaagaagctggtggccttctcgacttggattgaccgg
acacgctgggccaggaacacctgggccatgttagccatcttcatcctggttatggcaaat
gtcgtggacatgctgagctgcctccaatattccatgggacccaacaatggcactgcaggg
atagagacggagggtggttgcatggagaaccccaagtattacaactatgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaagtcagccacatggtgaagctcaccctcatg
ctgcttgtcacgggtgcggttgccgtcatcaacatctatgcctggtgccccatctttgat
gaatatgaccgcagacgtttccaggaacatgactttcctgtggtcgccttggagaagatg
cagatcctctccaccactgggctcaatggcactgacaggctgcccttagtgccttctaag
tacacgatgacagtgatgatcttcatcatgatgctgagcttctactacttctcccgccac
gtggaaaaactggcacggacattgttcttgtggaagattgaggtccatgaccagaaagaa
cgtgtctacgagatgcgacgctggaatgaggccttggtcaccaacatgttgcctgagcat
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataatggtggcattgagtgtctgcgcttcctcaacgagatcatctcagatttt
gactctcttctagacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagt
acctacatggcagcttcaggagtcaccccagatgtcaacaccaacggcttcaccagctcc
aacaaggaggaaaagtcagaaaaggagcgctggcaacacctggctgacctggctgacttt
gcactagccatgaaggatacccttacgaacatcaacaaccagtccttcaacaacttcatg
ctacgcataggcatgaacaaaggaggggtcctggctggagtcattggagcccggaaacca
cactacgacatctggggcaacacagtcaatgtagccagcaggatggagtctacaggggtc
atgggcaacattcaggtggtagaagaaacacaagccatccttcgagagtacggcttccgc
tttgtgaggcgagggcccatctttgtgaaagggaagggggagctgctaacttttttcttg
aaggggcgtgataagccagccaccttcccgaatgggtcctctgtgaccctgccccaccag
gtagtagacaactcctga

KEGG   Miniopterus natalensis: 107535777
Entry
107535777         CDS       T05883                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04114  Oocyte meiosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04727  GABAergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05032  Morphine addiction
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107535777 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107535777 (ADCY9)
   04371 Apelin signaling pathway
    107535777 (ADCY9)
   04020 Calcium signaling pathway
    107535777 (ADCY9)
   04072 Phospholipase D signaling pathway
    107535777 (ADCY9)
   04024 cAMP signaling pathway
    107535777 (ADCY9)
   04022 cGMP-PKG signaling pathway
    107535777 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107535777 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107535777 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107535777 (ADCY9)
   04062 Chemokine signaling pathway
    107535777 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    107535777 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    107535777 (ADCY9)
   04912 GnRH signaling pathway
    107535777 (ADCY9)
   04913 Ovarian steroidogenesis
    107535777 (ADCY9)
   04915 Estrogen signaling pathway
    107535777 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    107535777 (ADCY9)
   04921 Oxytocin signaling pathway
    107535777 (ADCY9)
   04926 Relaxin signaling pathway
    107535777 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    107535777 (ADCY9)
   04918 Thyroid hormone synthesis
    107535777 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    107535777 (ADCY9)
   04916 Melanogenesis
    107535777 (ADCY9)
   04925 Aldosterone synthesis and secretion
    107535777 (ADCY9)
   04927 Cortisol synthesis and secretion
    107535777 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107535777 (ADCY9)
   04270 Vascular smooth muscle contraction
    107535777 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    107535777 (ADCY9)
   04971 Gastric acid secretion
    107535777 (ADCY9)
   04972 Pancreatic secretion
    107535777 (ADCY9)
   04976 Bile secretion
    107535777 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107535777 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107535777 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    107535777 (ADCY9)
   04727 GABAergic synapse
    107535777 (ADCY9)
   04725 Cholinergic synapse
    107535777 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    107535777 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107535777 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    107535777 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    107535777 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107535777 (ADCY9)
   04714 Thermogenesis
    107535777 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535777 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    107535777 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107535777 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107535777 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107535777 (ADCY9)
   05163 Human cytomegalovirus infection
    107535777 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107535777 (ADCY9)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107535777 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 AC_N DUF1053
Other DBs
NCBI-GeneID: 107535777
NCBI-ProteinID: XP_016066833
LinkDB
Position
Unknown
AA seq 1353 aa
MASPPHQQLLQHHSTEVSCDSSGDNNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKMIFMAAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVFT
LLVFSLTLAAQFQVLTPLSGPVDSSNHTPAAKSTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFGYHFQDEDCFPSPEAGPRHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSMKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEHFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVVDQLKGLKTYLIAGQRAKESHCGCSEALLSGFEVIDGSQVS
SGPRGQGTTSPGSVSDLAQTVKTFDNLKTCPSCRITFAPKSEAGAEGGAVQNGCQEEHKN
NTKVSGGHNSKAQNGLLSPPQEEKLTNSQTSLCEILQEKGKWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELEQAYRTSYQEEVMKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAATTPPPPATLVVFGVALLLEVLSLVVSVR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHITSEFETNIHFTVFMGS
AILIAVVHYCNFCQLSSWMRSSLATIVGAGPLLLLYISLCPDSSIVMSHFNAVQNFSSER
NPCNSSLLHDSRRPASLVGQEMILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDNGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGIVPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQNLDKTCLGSENNTQAKDPHLSSKRPWKEPIKAEE
RCRFGKAIEKTDCEDMGMEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgat
tccagcggagacaacaacagcgtgagggtcaaaatcaaccccaagcagctgtcgtccaac
agccaccctaaacactgcaagtacagcatctcctccagttgtagcagctctggggactca
gggggcgtcccccggagagtgggcgccggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagtcggtggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcctggagcgctgcttcccgcaaacccagcgccgcttccggtatgcgctt
ttctacataggtttcgcctgcctgctctggagcatctattttggggtccacatgagatcc
aaaatgattttcatggcagctcctgctctgtgcttcctcgtggtgtgtgtgggctttttc
ctgtttaccttcaccaagctgtatgcccgacattatgtgtggacctcgctggttttcacc
ctcctggtgttcagcctgactctggctgcccagtttcaggttctgacgcctctctcggga
cctgttgacagttccaatcatactcccgcagctaagtccacagacacttgcttatctcaa
gtggggagcttttccatgtgcattgaagttctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtttttgggagtggcatactctgtactttttgagacctttggc
tatcatttccaagatgaagactgcttcccctcacctgaagcagggccccggcactgggag
ctgctgagccgagccctgctccatgtctgcattcatgccattgggatccacctattcatc
atgtcccaggtgagatctagaagcaccttcctcaaggtgggacagtcaattatgcatggg
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcattgctgatgacttgatgaaacagggggatgaggagagtgagaattctatgaaaagg
catgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctata
gcattccgcccatttaagatgcagcagattgaagaggtcagtattttatttgcagacatc
gtaggcttcaccaagatgagtgccaacaagtctgctcatgccctggtaggtctcctcaat
gatctgtttggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaatcagcacc
ctgggagactgctactactgtgtggcagggtgccccgaaccccgggctgaccatgcctat
tgctgcattgaaatgggcttgggcatgataagagccatcgagcacttctgccaggagaag
aaagaaatggtgaacatgcgtgttggggttcacacggggactgttttgtgtggcatcttg
ggcatgaggaggtttaaatttgatgtgtggtccaatgacgtgaacctggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttctgaggccactgcaaaataccttgat
gatcggtacgaaatggaggatgggagagttactgaacgcctcggccagagcgttgttgtt
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcggctgttcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggtcctaggggacaggggacaacatcaccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcatgcagaatcacgtttgctcccaaa
tcagaagctggtgcagaagggggcgcagtgcaaaatggctgtcaggaggagcataaaaat
aacaccaaggtttctggaggacataattccaaagcacaaaacggactcctgagccctccc
caagaggaaaaactcaccaatagccagacctccctgtgtgaaatcttacaggaaaaggga
aagtgggcaggtgtcagtttggaccagtctgctctcctcccgctgaggttcaagaacatc
cgggagaaaacagacgcccactttgttgatgttatcaaagaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcttgaacttcctggatcaggagctagag
caagcctacagaaccagctatcaagaagaggttatgaaaaattctccggtgaagactttt
gctagtgccaccttcagctccctcctggatgtgtttctgtcaacaacagtgtttctgatt
ctctccatcacgtgcttcctgaagtacggggctgccaccacgcctcccccgccagccacc
ttggtggtctttggggtagccctgctactggaggtgctgtccctcgtggtctctgtcagg
atggtgtttttcctggaggatgtgatggcttgtaccaagcgcctgctggagtggatagcc
ggctggctgccacgccatttcattggtgccatcctggtgtcacttcccgctctcgcagtc
tattcacacatcacttccgaatttgagacaaacatacatttcaccgtgttcatgggctca
gccatcctcatcgctgtggtgcactattgtaacttctgccagctcagctcctggatgcgc
tcttccttagccaccatcgtcggggctgggcccctgcttctgctctacatctccctgtgc
ccagacagttccatagtaatgtcacattttaatgcagtacagaatttcagttccgagagg
aatccatgcaatagttcattgctgcatgacagcaggagaccagccagcctggttggccag
gagatgattctcgtcttctttctcttgctcttgttggtctggttcctgaatcgagaattt
gaagtcagctaccgcctgcactaccatggggatgtggaggcagaccttcaccgcaccaag
atccagagcatgagggaccaagccgactggctgctgaggaacatcatcccctaccatgtg
gctgagcagctgaaggtttcccagacctactccaagaatcacgacaatgggggagtcatc
tttgccagcattgtcaacttcagtgagttctatgaggagaactacgagggaggcaaggag
tgctaccgggtcctcaacgagctgataggggacttcgatgaactcctgagcaagccagac
tacagcagcattgagaagattaaaaccattggagccacatacatggccgcatcggggctg
aatgccacacagtgccaggatggcagccatccacaggaacacctacagattctgtttgag
tttgccaaggagatgatgcgtgtggtggatgacttcaacaacaacatgctgtggttcaac
ttcaaactcagagttggcttcaaccacggacccttgacagcaggggtcattggcactacc
aagctactgtatgacatctggggagacactgtcaacatcgccagcaggatggacaccaca
ggagtggagtgccgcatccaagtgagtgaagaaagctaccgggtcctcagcaagatgggc
tacgactttgactacaggggcacagtgaatgtcaagggtaagggtcagatgaagacctac
ctttacccaaagtgcacagacaacgggatcgtgccacagcaccagctgtccatttcccca
gacatccgagtccaggtggacggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtacagaacttggacaagacatgtctgggttctgagaacaacacgcag
gccaaggaccctcacctgtcttctaagagaccctggaaagagcctatcaaagccgaagaa
aggtgtcgatttggcaaagccatagagaaaactgactgtgaagatatggggatggaagaa
gccaatgaactcaccaagctcaatgtctcaaagagtgtatga

DBGET integrated database retrieval system