KEGG   Miniopterus natalensis: 107528285
Entry
107528285         CDS       T05883                                 

Gene name
NR4A1
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528285 (NR4A1)
   04151 PI3K-Akt signaling pathway
    107528285 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107528285 (NR4A1)
   04927 Cortisol synthesis and secretion
    107528285 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107528285 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107528285 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mna03310]
    107528285 (NR4A1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    107528285 (NR4A1)
Nuclear receptors [BR:mna03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   107528285 (NR4A1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107528285
NCBI-ProteinID: XP_016056798
LinkDB
Position
Unknown
AA seq 598 aa
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFSKPTMDLASPEAAPTAPTALPSFSTFMDGY
TGEFDTFLYQLPGTAQPPSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGTLSGPL
DETLSSSGSDYYGSPCSAPSPPTPGLQPPQLSPWDGSFGPFSPNQTYESLRAWTEQLPKA
PGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLVEGESYSMPTAFPGLVPTSPHL
DGPGMLNVPVTSAKSRSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPRQPPDAS
PANLLTSLVRAHLDSGPSMAKLDYSKFQELVLPHFGKEDARDVQQFYDLLSGSLEVIRKW
AEKIPGFAELCTGDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCTRGFG
DWIDGILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHIS
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMETLPF
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccaagcccgggaccccgtgaccac
ctggcaagcgatccgctgacccccgagttcagcaagcccaccatggacctcgccagccct
gaggcggctcccactgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggggagtttgacaccttcctctaccagctgccgggaacagcccagccaccctcctct
gcctcctcctctgcctcctccacatcgtcgtcctcagccacctcccctgcctctgcttcc
ttcaagttcgaggacttccaggtgtacggctgctaccctggcaccctgagcggcccgcta
gatgagaccctatcctccagtggctctgactactatggcagtccctgctcagccccgtca
ccgcccacgcccggccttcagccaccccaactctctccctgggacggctcctttggcccc
ttctcacccaaccagacttatgaaagcctgcgggcatggacagagcagcttcccaaggct
cctgggcccccccagccaccggccttcttttccttcagtccccccaccggccccagcccc
agcctggcccagagccctctgaagctgttcccctcgcaggccacccaccagctggtggag
ggagagagctattccatgccaacagctttcccaggcctggtgcccacgtctccacacctt
gatggcccagggatgctgaatgtgcctgtgacctcagccaagtctcggagtggggcccca
ggaggaagcgagggccgctgtgctgtgtgtggggacaatgcttcatgtcagcattacggt
gtccgcacctgcgagggctgcaagggcttcttcaagcgcacagtgcagaaaaatgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggcagtgggcatggtgaaggaagttgtccggacagac
agcctgaaggggcggcggggacggctcccttcaaagcccaggcagcccccagatgcctcc
cctgccaatctcctcacctccctggtccgggcacacctggactcagggcccagcatggct
aaactggactactccaagttccaggagctagtgctgccccactttgggaaggaggatgcc
agggacgtgcagcagttctacgacctgctctcagggtccctggaggtcatccgcaagtgg
gccgagaagatccctggcttcgcggagctgtgcacaggcgaccaggacctgttgctggag
tcggccttcctggagctcttcatccttcgcctggcctaccggtctaagccagcggagggg
aagctcatcttctgctccggcctggtgctacaccggctacagtgcacccgaggcttcggc
gactggatcgatggcattctggccttctctcggtccctgcacagcttggttgttgatgtc
cctgccttcgcctgcctctccgcgcttgtcctcatcacagaccggcacgggctgcaggag
cctcggcgggtggaggagctgcagaaccgcatcgccagctgcctgaaggagcacatctct
gctgtggcgggcgagccccagccggccagctgcctgtcccgcctgctgggcaagctgcct
gagctacggaccctatgcacccagggcctgcagcgaatcttctacctcaagctggaggac
ttggtgccccctccacccatcgtggacaagatctttatggagacgctgcccttctga

DBGET integrated database retrieval system