KEGG   Miniopterus natalensis: 107528331
Entry
107528331         CDS       T05883                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04920  Adipocytokine signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528331 (AKT3)
   04012 ErbB signaling pathway
    107528331 (AKT3)
   04014 Ras signaling pathway
    107528331 (AKT3)
   04015 Rap1 signaling pathway
    107528331 (AKT3)
   04370 VEGF signaling pathway
    107528331 (AKT3)
   04371 Apelin signaling pathway
    107528331 (AKT3)
   04630 JAK-STAT signaling pathway
    107528331 (AKT3)
   04668 TNF signaling pathway
    107528331 (AKT3)
   04066 HIF-1 signaling pathway
    107528331 (AKT3)
   04068 FoxO signaling pathway
    107528331 (AKT3)
   04072 Phospholipase D signaling pathway
    107528331 (AKT3)
   04071 Sphingolipid signaling pathway
    107528331 (AKT3)
   04024 cAMP signaling pathway
    107528331 (AKT3)
   04022 cGMP-PKG signaling pathway
    107528331 (AKT3)
   04151 PI3K-Akt signaling pathway
    107528331 (AKT3)
   04152 AMPK signaling pathway
    107528331 (AKT3)
   04150 mTOR signaling pathway
    107528331 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107528331 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    107528331 (AKT3)
   04218 Cellular senescence
    107528331 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107528331 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107528331 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107528331 (AKT3)
   04613 Neutrophil extracellular trap formation
    107528331 (AKT3)
   04620 Toll-like receptor signaling pathway
    107528331 (AKT3)
   04625 C-type lectin receptor signaling pathway
    107528331 (AKT3)
   04660 T cell receptor signaling pathway
    107528331 (AKT3)
   04662 B cell receptor signaling pathway
    107528331 (AKT3)
   04664 Fc epsilon RI signaling pathway
    107528331 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    107528331 (AKT3)
   04062 Chemokine signaling pathway
    107528331 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107528331 (AKT3)
   04922 Glucagon signaling pathway
    107528331 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    107528331 (AKT3)
   04920 Adipocytokine signaling pathway
    107528331 (AKT3)
   04929 GnRH secretion
    107528331 (AKT3)
   04915 Estrogen signaling pathway
    107528331 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    107528331 (AKT3)
   04917 Prolactin signaling pathway
    107528331 (AKT3)
   04926 Relaxin signaling pathway
    107528331 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    107528331 (AKT3)
   04919 Thyroid hormone signaling pathway
    107528331 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107528331 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107528331 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    107528331 (AKT3)
   04728 Dopaminergic synapse
    107528331 (AKT3)
   04722 Neurotrophin signaling pathway
    107528331 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528331 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    107528331 (AKT3)
   04213 Longevity regulating pathway - multiple species
    107528331 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528331 (AKT3)
   05205 Proteoglycans in cancer
    107528331 (AKT3)
   05230 Central carbon metabolism in cancer
    107528331 (AKT3)
   05231 Choline metabolism in cancer
    107528331 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107528331 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107528331 (AKT3)
   05212 Pancreatic cancer
    107528331 (AKT3)
   05225 Hepatocellular carcinoma
    107528331 (AKT3)
   05226 Gastric cancer
    107528331 (AKT3)
   05214 Glioma
    107528331 (AKT3)
   05221 Acute myeloid leukemia
    107528331 (AKT3)
   05220 Chronic myeloid leukemia
    107528331 (AKT3)
   05218 Melanoma
    107528331 (AKT3)
   05211 Renal cell carcinoma
    107528331 (AKT3)
   05215 Prostate cancer
    107528331 (AKT3)
   05213 Endometrial cancer
    107528331 (AKT3)
   05224 Breast cancer
    107528331 (AKT3)
   05222 Small cell lung cancer
    107528331 (AKT3)
   05223 Non-small cell lung cancer
    107528331 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528331 (AKT3)
   05017 Spinocerebellar ataxia
    107528331 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107528331 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107528331 (AKT3)
   04931 Insulin resistance
    107528331 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107528331 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528331 (AKT3)
   05135 Yersinia infection
    107528331 (AKT3)
   05152 Tuberculosis
    107528331 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528331 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    107528331 (AKT3)
   05161 Hepatitis B
    107528331 (AKT3)
   05160 Hepatitis C
    107528331 (AKT3)
   05164 Influenza A
    107528331 (AKT3)
   05162 Measles
    107528331 (AKT3)
   05168 Herpes simplex virus 1 infection
    107528331 (AKT3)
   05163 Human cytomegalovirus infection
    107528331 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528331 (AKT3)
   05169 Epstein-Barr virus infection
    107528331 (AKT3)
   05165 Human papillomavirus infection
    107528331 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107528331 (AKT3)
   05142 Chagas disease
    107528331 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107528331 (AKT3)
   01524 Platinum drug resistance
    107528331 (AKT3)
   01522 Endocrine resistance
    107528331 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107528331 (AKT3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107528331 (AKT3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107528331 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 107528331
NCBI-ProteinID: XP_016056884
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggcgaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagacgtggacttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatccgatgtctccagtggacc
actgttatagagcgaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctattcaggctgtcgcggacagacttcagaggcaagaagaggaaagaatgaattgcagt
ccaacttcacaaattgataatattggggaggaagagatggatgcttctaccacccaccat
aaaagaaagacaatgaatgactttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggccagtgggaagtattacgctatgaagattctgaag
aaagaagttattattgcaaaggatgaggtggcgcacactctcacagaaagcagggtcctg
aagaacaccagacaccccttcctaacatcattgaaatactccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtcaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctcggccctggac
tacctacactccgggaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagacgggcacataaaaattacggattttggactttgcaaagaagggatcacggatgca
gccactatgaagacgttctgtgggacaccagagtacctggcaccagaggtgttagaggac
aatgactatggccgagccgtggactggtggggcctgggtgtcgtcatgtatgaaatgatg
tgtgggaggctgcctttctacaaccaggatcacgaaaaactttttgaactaatactaatg
gaagacatcaaatttcctcgaaccctctcctcagatgcaaaatcactgctttcagggctc
ttgataaaggatccaaataaacgccttggcggagggccagatgatgcaaaagagattatg
agacacagtttcttctctggagtaaactggcaagacgtttatgataaaaagcttgtacct
ccttttaagcctcaagtaacatcagagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggcatggactgcgtg
gacaacgagcgacggccgcacttcccgcagttctcctactcggccagcgggcgcgagtag

KEGG   Miniopterus natalensis: 107534199
Entry
107534199         CDS       T05883                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04920  Adipocytokine signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107534199 (AKT2)
   04012 ErbB signaling pathway
    107534199 (AKT2)
   04014 Ras signaling pathway
    107534199 (AKT2)
   04015 Rap1 signaling pathway
    107534199 (AKT2)
   04370 VEGF signaling pathway
    107534199 (AKT2)
   04371 Apelin signaling pathway
    107534199 (AKT2)
   04630 JAK-STAT signaling pathway
    107534199 (AKT2)
   04668 TNF signaling pathway
    107534199 (AKT2)
   04066 HIF-1 signaling pathway
    107534199 (AKT2)
   04068 FoxO signaling pathway
    107534199 (AKT2)
   04072 Phospholipase D signaling pathway
    107534199 (AKT2)
   04071 Sphingolipid signaling pathway
    107534199 (AKT2)
   04024 cAMP signaling pathway
    107534199 (AKT2)
   04022 cGMP-PKG signaling pathway
    107534199 (AKT2)
   04151 PI3K-Akt signaling pathway
    107534199 (AKT2)
   04152 AMPK signaling pathway
    107534199 (AKT2)
   04150 mTOR signaling pathway
    107534199 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107534199 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    107534199 (AKT2)
   04218 Cellular senescence
    107534199 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107534199 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107534199 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107534199 (AKT2)
   04613 Neutrophil extracellular trap formation
    107534199 (AKT2)
   04620 Toll-like receptor signaling pathway
    107534199 (AKT2)
   04625 C-type lectin receptor signaling pathway
    107534199 (AKT2)
   04660 T cell receptor signaling pathway
    107534199 (AKT2)
   04662 B cell receptor signaling pathway
    107534199 (AKT2)
   04664 Fc epsilon RI signaling pathway
    107534199 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    107534199 (AKT2)
   04062 Chemokine signaling pathway
    107534199 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107534199 (AKT2)
   04922 Glucagon signaling pathway
    107534199 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    107534199 (AKT2)
   04920 Adipocytokine signaling pathway
    107534199 (AKT2)
   04929 GnRH secretion
    107534199 (AKT2)
   04915 Estrogen signaling pathway
    107534199 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    107534199 (AKT2)
   04917 Prolactin signaling pathway
    107534199 (AKT2)
   04926 Relaxin signaling pathway
    107534199 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    107534199 (AKT2)
   04919 Thyroid hormone signaling pathway
    107534199 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107534199 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107534199 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    107534199 (AKT2)
   04728 Dopaminergic synapse
    107534199 (AKT2)
   04722 Neurotrophin signaling pathway
    107534199 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107534199 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    107534199 (AKT2)
   04213 Longevity regulating pathway - multiple species
    107534199 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534199 (AKT2)
   05205 Proteoglycans in cancer
    107534199 (AKT2)
   05230 Central carbon metabolism in cancer
    107534199 (AKT2)
   05231 Choline metabolism in cancer
    107534199 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107534199 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107534199 (AKT2)
   05212 Pancreatic cancer
    107534199 (AKT2)
   05225 Hepatocellular carcinoma
    107534199 (AKT2)
   05226 Gastric cancer
    107534199 (AKT2)
   05214 Glioma
    107534199 (AKT2)
   05221 Acute myeloid leukemia
    107534199 (AKT2)
   05220 Chronic myeloid leukemia
    107534199 (AKT2)
   05218 Melanoma
    107534199 (AKT2)
   05211 Renal cell carcinoma
    107534199 (AKT2)
   05215 Prostate cancer
    107534199 (AKT2)
   05213 Endometrial cancer
    107534199 (AKT2)
   05224 Breast cancer
    107534199 (AKT2)
   05222 Small cell lung cancer
    107534199 (AKT2)
   05223 Non-small cell lung cancer
    107534199 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107534199 (AKT2)
   05017 Spinocerebellar ataxia
    107534199 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107534199 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107534199 (AKT2)
   04931 Insulin resistance
    107534199 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107534199 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107534199 (AKT2)
   05135 Yersinia infection
    107534199 (AKT2)
   05152 Tuberculosis
    107534199 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107534199 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    107534199 (AKT2)
   05161 Hepatitis B
    107534199 (AKT2)
   05160 Hepatitis C
    107534199 (AKT2)
   05164 Influenza A
    107534199 (AKT2)
   05162 Measles
    107534199 (AKT2)
   05168 Herpes simplex virus 1 infection
    107534199 (AKT2)
   05163 Human cytomegalovirus infection
    107534199 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107534199 (AKT2)
   05169 Epstein-Barr virus infection
    107534199 (AKT2)
   05165 Human papillomavirus infection
    107534199 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107534199 (AKT2)
   05142 Chagas disease
    107534199 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107534199 (AKT2)
   01524 Platinum drug resistance
    107534199 (AKT2)
   01522 Endocrine resistance
    107534199 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107534199 (AKT2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107534199 (AKT2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107534199 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107534199
NCBI-ProteinID: XP_016064696
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLPPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDLDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagtgatggctccttcattggctacaaggag
cggcccgaggcccctgaccagaccctgccccccctaaacaacttctctgttgcagaatgc
cagctgatgaagactgagagaccacggcccaacacatttgtcatacgctgcctacagtgg
accacagtcatcgagaggactttccacgtagactctccagatgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaaacagcggggcccgggtgaggaccccatg
gactacaagtgtggctcccccagtgactcttctgcagctgaggagatggaagtggccgtt
agcaaggcacgggccaaggtgaccatgaacgacttcgactatctcaagctcctgggcaag
ggcaccttcggcaaagtcatcctggtgcgggagaaggccaccggccgctactatgccatg
aagatcctgcggaaggaggtcatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccattcctcactgcactgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgctaacggtggggagctgttcttccac
ctgtcccgggagcgcgtcttcacggaggagcgggcacgcttctatggcgcagagatcgtc
tcagccctggagtacctgcactccagggatgtagtgtaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcaccgactttggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgcgggacccccgaatatctggcacccgag
gtcctggaggacaacgactatggccgtgccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
ctggctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgacgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtacagaag
aagctcccgccacccttcaaacctcaggtcacgtctgaggttgacacaaggtacttcgat
gatgagttcactgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
tccctcgacctggaccagcggactcacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Miniopterus natalensis: 107542383
Entry
107542383         CDS       T05883                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04920  Adipocytokine signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107542383 (AKT1)
   04012 ErbB signaling pathway
    107542383 (AKT1)
   04014 Ras signaling pathway
    107542383 (AKT1)
   04015 Rap1 signaling pathway
    107542383 (AKT1)
   04370 VEGF signaling pathway
    107542383 (AKT1)
   04371 Apelin signaling pathway
    107542383 (AKT1)
   04630 JAK-STAT signaling pathway
    107542383 (AKT1)
   04668 TNF signaling pathway
    107542383 (AKT1)
   04066 HIF-1 signaling pathway
    107542383 (AKT1)
   04068 FoxO signaling pathway
    107542383 (AKT1)
   04072 Phospholipase D signaling pathway
    107542383 (AKT1)
   04071 Sphingolipid signaling pathway
    107542383 (AKT1)
   04024 cAMP signaling pathway
    107542383 (AKT1)
   04022 cGMP-PKG signaling pathway
    107542383 (AKT1)
   04151 PI3K-Akt signaling pathway
    107542383 (AKT1)
   04152 AMPK signaling pathway
    107542383 (AKT1)
   04150 mTOR signaling pathway
    107542383 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107542383 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    107542383 (AKT1)
   04218 Cellular senescence
    107542383 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107542383 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107542383 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542383 (AKT1)
   04613 Neutrophil extracellular trap formation
    107542383 (AKT1)
   04620 Toll-like receptor signaling pathway
    107542383 (AKT1)
   04625 C-type lectin receptor signaling pathway
    107542383 (AKT1)
   04660 T cell receptor signaling pathway
    107542383 (AKT1)
   04662 B cell receptor signaling pathway
    107542383 (AKT1)
   04664 Fc epsilon RI signaling pathway
    107542383 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    107542383 (AKT1)
   04062 Chemokine signaling pathway
    107542383 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107542383 (AKT1)
   04922 Glucagon signaling pathway
    107542383 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    107542383 (AKT1)
   04920 Adipocytokine signaling pathway
    107542383 (AKT1)
   04929 GnRH secretion
    107542383 (AKT1)
   04915 Estrogen signaling pathway
    107542383 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    107542383 (AKT1)
   04917 Prolactin signaling pathway
    107542383 (AKT1)
   04926 Relaxin signaling pathway
    107542383 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    107542383 (AKT1)
   04919 Thyroid hormone signaling pathway
    107542383 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107542383 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107542383 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    107542383 (AKT1)
   04728 Dopaminergic synapse
    107542383 (AKT1)
   04722 Neurotrophin signaling pathway
    107542383 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107542383 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    107542383 (AKT1)
   04213 Longevity regulating pathway - multiple species
    107542383 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542383 (AKT1)
   05205 Proteoglycans in cancer
    107542383 (AKT1)
   05230 Central carbon metabolism in cancer
    107542383 (AKT1)
   05231 Choline metabolism in cancer
    107542383 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107542383 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107542383 (AKT1)
   05212 Pancreatic cancer
    107542383 (AKT1)
   05225 Hepatocellular carcinoma
    107542383 (AKT1)
   05226 Gastric cancer
    107542383 (AKT1)
   05214 Glioma
    107542383 (AKT1)
   05221 Acute myeloid leukemia
    107542383 (AKT1)
   05220 Chronic myeloid leukemia
    107542383 (AKT1)
   05218 Melanoma
    107542383 (AKT1)
   05211 Renal cell carcinoma
    107542383 (AKT1)
   05215 Prostate cancer
    107542383 (AKT1)
   05213 Endometrial cancer
    107542383 (AKT1)
   05224 Breast cancer
    107542383 (AKT1)
   05222 Small cell lung cancer
    107542383 (AKT1)
   05223 Non-small cell lung cancer
    107542383 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542383 (AKT1)
   05017 Spinocerebellar ataxia
    107542383 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107542383 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107542383 (AKT1)
   04931 Insulin resistance
    107542383 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107542383 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542383 (AKT1)
   05135 Yersinia infection
    107542383 (AKT1)
   05152 Tuberculosis
    107542383 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542383 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    107542383 (AKT1)
   05161 Hepatitis B
    107542383 (AKT1)
   05160 Hepatitis C
    107542383 (AKT1)
   05164 Influenza A
    107542383 (AKT1)
   05162 Measles
    107542383 (AKT1)
   05168 Herpes simplex virus 1 infection
    107542383 (AKT1)
   05163 Human cytomegalovirus infection
    107542383 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107542383 (AKT1)
   05169 Epstein-Barr virus infection
    107542383 (AKT1)
   05165 Human papillomavirus infection
    107542383 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542383 (AKT1)
   05142 Chagas disease
    107542383 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107542383 (AKT1)
   01524 Platinum drug resistance
    107542383 (AKT1)
   01522 Endocrine resistance
    107542383 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542383 (AKT1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107542383 (AKT1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107542383 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107542383
NCBI-ProteinID: XP_016075178
LinkDB
Position
Unknown
AA seq 439 aa
MNDVAIVKEGWLHKRGQASETLRKEVRVSRSLGPGPSRCPPAFLLLLEGPVLGEREEWTT
AIQTVADGLKRQEEEMMDFRSGSPSDNSGAEEMEVALAKPKHRVTMNEFEYLKLLGKGTF
GKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHD
RLCFVMEYANGGELFFHLSRERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLM
LDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYE
MMCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKALLSGLLKKDPKQRLGGGSEDAKE
IMQHGFFASIVWQDVYEKKLIPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMDCV
DSERRPHFPQFSYSASGTA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaatgacgtggccatcgtgaaggagggctggttgcacaaacgaggccaggcatccgag
accctgaggaaagaggtccgtgtgtctcggagccttggtcctggcccctctaggtgcccc
ccggccttcctgcttctcctggaggggcctgtgctgggcgaaagggaggagtggacgact
gccatccagaccgtggccgacgggctcaagaggcaggaggaggagatgatggacttccgc
tcaggctcacccagcgacaactcaggagccgaagagatggaggtggctctggccaagccc
aagcaccgtgtgaccatgaacgagtttgagtacctcaagctgctgggcaagggcaccttc
gggaaggtgatcctcgtgaaggagaaggccaccggccgctactacgccatgaagatcctc
aagaaggaagtcatcgtggccaaggacgaagtggcccacacgctcacggagaaccgtgtc
ctgcagaactcccggcaccccttcctcacggccctgaagtactccttccagacccacgac
cgcctctgctttgtcatggagtacgccaatggcggagagctcttcttccacctgtcccgg
gagcgggtgttccccgaggaccgcgcccgcttctatggtgcggagatcgtgtcggccctg
gactacctgcactcggaaaagaacgtcgtctaccgtgacctcaagttggagaacctgatg
ctggacaaagacgggcacatcaagatcaccgacttcgggctgtgcaaggagggaatcaag
gacggggccaccatgaagaccttctgcgggacccccgagtacctggccccagaggtgctg
gaggacaatgactacggccgcgccgtggactggtgggggctgggcgtggtcatgtacgag
atgatgtgcggccggctgcccttctacaaccaggaccacgagaagctcttcgagctgatc
ctcatggaggagatccgcttcccccgcacgctcagccccgaggccaaggccctgctgtcc
gggctgctcaagaaggaccccaagcagaggcttggagggggctcggaggacgccaaggag
atcatgcagcacggcttctttgccagcatcgtgtggcaggacgtatacgagaagaagctc
atcccgcccttcaagccccaggtcacatcggagaccgacaccaggtattttgacgaggag
ttcacagcccagatgatcaccataacgccgccggaccaagacgacaacatggattgtgtg
gacagcgagcggaggccccacttcccacagttctcctactcggccagcggcacggcctga

DBGET integrated database retrieval system