KEGG   Miniopterus natalensis: 107528389
Entry
107528389         CDS       T05883                                 

Gene name
KCNJ2
Definition
(RefSeq) inward rectifier potassium channel 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107528389 (KCNJ2)
   04924 Renin secretion
    107528389 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    107528389 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    107528389 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528389 (KCNJ2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107528389 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 107528389
NCBI-ProteinID: XP_016056954
LinkDB
Position
Unknown
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFVN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDATKESK
ACVSEVKSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPFYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEEDSDNGVPESTSMDTPPDINLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagcgtgcggaccaaccgctacagcatcgtgtcctccgaggaagacggcatgaag
ctggccaccatggcggtcgccaacggcttcgggaacggcaagagcaaagtccacacccga
cagcagtgcaggagccgctttgtgaagaaagacgggcactgcaacgttcagttcgtgaac
gtgggggagaagggacagcggtacctggcggacatcttcaccacgtgcgtggacattcgc
tggcggtggatgctggtcatcttctgcctggccttcgtgctgtcctggctgttcttcggc
tgcgtgttttggttgatagccctgctccacggggacctggatgccaccaaggagagcaaa
gcctgcgtgtccgaggtcaagagcttcacggccgccttcctcttctccattgagacccag
accaccataggctacggcttcaggtgcgtcacggacgagtgcccgatcgccgttttcatg
gtggtcttccagtcgatcgtgggctgcatcatcgacgcctttatcatcggcgcggtcatg
gccaagatggccaaaccgaagaagaggaacgagactctcgtcttcagtcacaacgctgtg
atcgccatgagagacggcaagctgtgcctgatgtggcgagtgggcaaccttcggaagagc
cacctggtggaggctcacgttcgggcccagctcctcaaatccagaattacttcggaaggg
gagtacatccccctggatcaaatagacatcaacgtcgggtttgacagcggcattgaccgt
atatttctggtgtcccccatcaccatagtccatgaaatcgacgaagacagccctttctat
gacttgagcaagcaggacattgacaacgcagactttgaaatcgtcgtgatcctggaaggc
atggtggaggccacggccatgaccacccagtgccgtagctcgtacctggccaacgagatc
ctctggggccaccgctacgagcccgtcctctttgaggagaagcattactacaaagtggac
tattccaggttccacaagacctatgaggtccccaacacgcccctctgcagcgccagagac
ttagccgagaagaaatacatcctttccaacgcaaattcattttgctatgaaaatgaggtg
gccctcacgagcaaagaggaggaagacagtgacaatggcgttccggaaagcacgagcatg
gacacgccgcccgacataaaccttcacaaccaggccagcgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

KEGG   Miniopterus natalensis: 107531170
Entry
107531170         CDS       T05883                                 

Gene name
KCNQ4
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 4
  KO
K04929  potassium voltage-gated channel KQT-like subfamily member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107531170 (KCNQ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531170 (KCNQ4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107531170 (KCNQ4)
SSDB
Motif
Pfam: KCNQ_channel Cas9_C
Other DBs
NCBI-GeneID: 107531170
NCBI-ProteinID: XP_016060645
LinkDB
Position
Unknown
AA seq 356 aa
MPAANLIQAAWRLYSTDRNRAYLTATWYYYDSILPSFRELALLFEHVQRARNGGLRPLEV
RRAPVPDGAPSRYPPVATCHRPGSASFCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPP
SMATSPSSEQVGEATSPTKVQKSWSFNDRTRFRASLRLKPRASAEEGPSEEVAEEKSYQC
ELTVDDVMPAVKTVIRSVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSL
QARVDQIVGRCPGDRKAREKGDKGPSDTEAADEVSMMGRVVKVEKQVQSIEHKLDLLLGF
YSRCLRSGTSASLGTVQVPLLDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgccagcagccaacctcattcaggctgcatggcgcctatactccaccgacaggaaccgg
gcctacctgacagccacctggtactactacgacagtatcctcccatccttcagagagctg
gccctcttgtttgagcacgtgcaacgggcccgcaatgggggcctacggcccctggaggtg
cggcgggcgccagtacccgacggagcgccctcccgttacccgcccgttgccacctgccac
cggccgggcagcgcctccttctgccctggggaaagcagccggatgggcatcaaagaccgc
atccgcatgggcagctcccagcggcggacaggcccctccaagcagcacctggcaccgccg
tcaatggccacctccccgagcagcgagcaggtgggtgaggccaccagccccaccaaggtc
cagaagagctggagcttcaatgaccgcacccgcttccgggcctctctgagactcaaaccc
cgagcttctgctgaggagggcccctccgaggaagtagcagaggaaaagagctaccagtgc
gagctcacggtggacgacgtcatgcctgcggtaaagacggtcatccgctctgtcaggatc
ctgaagttcctggtggccaaaaggaaattcaaggagacgctgcgaccctacgacgtgaag
gacgtcatcgagcagtactcggcagggcacctggacatgctgggccggatcaagagcctg
caggctcgggtggaccagattgtgggaaggtgccccggggaccggaaggcccgggagaag
ggcgacaaggggccctcggacacggaggcggcggatgaagttagtatgatgggacgcgtg
gtcaaggtggagaagcaggtgcagtccatcgagcacaagctggacctgctgctgggcttc
tactcgaggtgcctgcgctcgggcacctcggccagcctgggcaccgttcaagtgccgctt
ttagaccccgacatcacctcggactaccacagccctgtggaccacgaggacatctccgtc
tccgcacagacgctcagcatctcccgctcggtcagcaccaacatggactga

KEGG   Miniopterus natalensis: 107531620
Entry
107531620         CDS       T05883                                 

Gene name
KCNQ5
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 5
  KO
K04930  potassium voltage-gated channel KQT-like subfamily member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107531620 (KCNQ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531620 (KCNQ5)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107531620 (KCNQ5)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 107531620
NCBI-ProteinID: XP_016061226
LinkDB
Position
Unknown
AA seq 682 aa
MVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYADA
LWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQK
HFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTNQKLSFKERVRMASP
RGQSIKSRQASIGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPMIDA
DTALGTDDAYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVI
EQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVE
KQVQSIESKLDCLLDIYQQVLRKGSASALTLASFQIPPFECEQTSDYQSPVDSKDLSSSA
QNSGCLTRSASANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPLSQSDGPSAAATN
NIANQINAAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDVTTCLVASKEN
VQVAQSNLTKDRSLRKSFDMGGETLLSVHPVAPKDLGKSLSVQNLIRSTEELNIQLSGSE
SSGSRGSQDFYPKWRESKLFITDEEVGSEETETDTFDAVPQPARETAFASDSLRTGRSRS
SQSICKAGESTDALSLPHVKLK
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggtgcgcatggaccgcaggggaggcacgtggaaattactaggctcagtggtttatgct
cacagcaaggaattaatcacagcttggtacataggatttttggttcttattttttcgtct
ttccttgtctacctggtggaaaaagacgccaataaagagttttctacgtacgcggatgcc
ctgtggtggggcacgattacattgacaacgattggctatggagacaaaactcccctaact
tggctgggaagattgctttctgcaggctttgcgctccttggcatttctttctttgcactt
cctgccggcattcttggctcagggttcgcattaaaagtacaagaacagcaccgccagaaa
cactttgagaaaagaaggaacccagctgccaacctcattcagtgtgtctggcgtagttac
gcagctgatgagaaatctgtttccattgcaacctggaagccgcacttgaaggccctgcac
acctgcagccctaccaatcagaagctaagttttaaggagcgtgtgcgcatggctagccca
agaggccagagtattaagagcagacaagcctcaataggtgacaggaggtccccgagcacc
gacatcacagccgagggcagccccaccaaagtgcagaagagctggagcttcaacgaccga
acccgcttccggccctctctgcgcctcaaaagttctcagcccaaaccaatgatagacgct
gacaccgcgcttggcactgatgatgcatatgatgaaaaaggatgccagtgtgatgtatct
gtagaagacctcaccccaccgcttaaaactgtcattcgagctatcagaattatgaaattt
catgttgcaaaacggaaatttaaagaaacattacgcccatatgatgtaaaagatgtcatt
gaacagtattctgctggtcacctggacatgttgtgtagaattaagagccttcaaacacgt
gttgatcaaattcttggaaaagggcaaatcacatcagataagaagagccgagagaaaata
acagcagaacatgagaccacagatgacctcagtatgcttggccgggtggtcaaggttgaa
aaacaggtgcagtccattgagtccaagctggactgcctgctagatatatatcaacaggtc
ctccggaaaggctccgcctcagccctcactttggcctcattccagatcccaccttttgaa
tgtgaacagacatctgactatcaaagccccgtggacagcaaagacctgtccagctctgca
cagaacagtggctgcttaaccagatcagccagcgccaacatctctcgaggcctgcagttc
attctgacgccaaatgagttcagcgctcagactttctacgcgcttagccctactatgcac
agtcaagcaacacaggtgccactgagtcaaagcgatggcccctcagcggcggccaccaac
aacattgcaaaccaaataaacgcggcacctaagccagcagccccaacaactttacagatc
ccgcctcctctcccagccatcaagcatctgcccaggccagagaccctgcacccgaacccc
gcaggcttacaggagagcatttctgatgtcaccacctgccttgttgcctccaaggaaaat
gttcaggttgcacagtcaaacctgaccaaggacaggtctctgaggaagagctttgacatg
ggaggagaaactctgttgtctgtccacccggtggcgcccaaggacttaggcaaatctttg
tctgtacaaaacctgatcaggtccacagaggaactgaatatacagctttcagggagtgag
tcaagtggctccagaggcagccaagatttttaccccaaatggagggaatccaaattgttt
ataactgatgaagaggtgggttcggaagagacggagacagacacttttgatgccgtgccg
cagcctgccagggaaactgcttttgcgtcagactctctaaggactggaaggtctcgatca
tctcagagcatttgtaaggccggagaaagtacagatgccctcagcttgcctcacgtcaaa
ctgaaatga

KEGG   Miniopterus natalensis: 107531814
Entry
107531814         CDS       T05883                                 

Gene name
KCNJ14
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107531814 (KCNJ14)
  09156 Nervous system
   04725 Cholinergic synapse
    107531814 (KCNJ14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531814 (KCNJ14)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107531814 (KCNJ14)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 FSAP_sig_propep
Other DBs
NCBI-GeneID: 107531814
NCBI-ProteinID: XP_016061449
LinkDB
Position
Unknown
AA seq 409 aa
MGLAEALRRLSGALESGASGAGDEEAGPALCDGHCNVRFVNLGGQGARYLSDLFTTCVDV
RWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPPPAAPCFSHVASFLAAFLFALET
QTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLIFSENA
VVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDSGTD
RIFLVSPITIVHEIDSSSPLYELGRAELAQADFELVVILEGMVEATAMTTQCRSSYLPGE
LLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAQQDSHSPKSSFPGS
LTAFCYENELALSFCQEEEEAKEGEEEEAEDGATSPRILTPTLALTLPP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggcctggccgaggccctgcgccgcctgagcggcgccctggagtcgggggccagcggg
gcgggcgatgaggaggccgggcctgcgctgtgcgacggccactgcaacgtgcgcttcgtg
aacctggggggccagggcgcgcgctacctgagcgacctgttcaccacgtgcgtggacgtg
cgctggcgctggatgtgcctgctcttctcctgctccttcctcgcctcctggctgctcttc
ggcctggcgttctggctcatcgcctcgctgcacggcgacctggccgcnccgccgcccgcc
gcgccctgcttctcgcacgtggccagcttcctggccgccttcctgttcgcgctggagacg
cagacgtccatcggctacggcgtgcgcagcgtcacggaggagtgcccggccgccgtggcc
gccgtggtgctgcagtgcatcgccggctgcgtgctcgacgccttcgtcgtgggcgccgtc
atggccaagatggccaagcccaagaagcgcaacgagacgctcatcttcagcgagaacgcc
gtcgtggcgctgcgcgaccgccgcctctgcctcatgtggcgcgtgggaaacctgcgccgc
agccacctggtcgaggcccacgtgcgggcgcagctgttgcagcctcgtgtgactccggaa
ggtgagtacataccactggaccaccaggatgtggacgtgggctttgacagtggcactgat
cgcatcttccttgtgtctcccatcaccatcgtgcacgagattgactcctccagtccactc
tatgaactaggacgtgccgagctggcccaggccgactttgagctagtggtcattctggag
ggcatggttgaggccacggctatgaccacacagtgtcgctcttcctatctccctggtgag
ctgctctggggccatcgttttgagccagtcctcttccagcgtggctcccagtatgaggtc
gactatcgccacttccatcgcacttatgaggtcccagggacaccagtctgcagcgccaag
gagctggatgaacgggcacagcaggattcccacagccccaagtctagcttccctggctct
ctgactgcattttgttatgagaatgaacttgctctgagcttctgtcaggaggaagaggaa
gccaaggagggggaggaggaggaggcagaagatggggccaccagcccccgaatactcaca
ccaaccctggcgctgaccttgcccccatga

KEGG   Miniopterus natalensis: 107539489
Entry
107539489         CDS       T05883                                 

Gene name
KCNQ3
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 3
  KO
K04928  potassium voltage-gated channel KQT-like subfamily member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107539489 (KCNQ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107539489 (KCNQ3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107539489 (KCNQ3)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd Ion_trans Ion_trans_2 Lig_chan
Other DBs
NCBI-GeneID: 107539489
NCBI-ProteinID: XP_016071476
LinkDB
Position
Unknown
AA seq 743 aa
MWFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGW
RGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTW
KLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGGEMKEEFETYADAL
WWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKH
FEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAASQKLGLL
DRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSS
EDAGTGEPMAEDRDYGNDFLVEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVI
EQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKPQKGAAFTYPPQQSPRNEPYVAR
ASTSEMEDQSMMGKFVKVERQVHDMGRKLDFLVDMHMQHMERLQVHVTDYDPTKGASPAE
VERRGDSRDPDLRSIICNYSETGAPDASYSFHQVPMDKVGPYRFSAHDPVSLPRGGPGPG
RGQAALPSSAAAHVERPTVLPILTLLDSRLSRQSPADPHGPCSDRVSPRQRRSFTRDSDT
PLSLMSVDHEELERSPSGFSISQDRDDVFGPSGGSSWMREKRYLAEGETDTDTDPFTPSG
SMPLSSTGDGISDSIWTPPSKPI
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgtggttcctgatcgtcctgggatgcttgatcctggctgtcctgaccacgttcaaggag
tacgagaccgtttcgggagactggcttctgttactggaaacattcgcgattttcatcttc
ggagccgagtttgctttgaggatctgggccgctggctgctgctgtcgatacaaaggctgg
cggggacggctgaagttcgccaggaagccactgtgcatgttggacatcttcgtgctgatt
gcctctgtgcccgtggtcgccgtgggcaaccagggcaatgtcctggccacgtccctgcgg
agcctgcgcttcctgcagatcctgcgcatgctacggatggaccggaggggcggcacctgg
aagctcctgggctcggccatctgcgcccacagcaaagagctcatcaccgcctggtacatt
gggttcctgacactcatcctgtcttcatttcttgtctacctggtcgagaaagacgtgccc
gaggtggatgcgcagggaggagagatgaaggaggagttcgagacctatgctgacgccctg
tggtggggcctgatcacactggccaccattggctacggagacaagacgcccaagacatgg
gaaggccgtctgattgcggctaccttctccttaatcggagtctccttttttgccctgccg
gcgggcatcctggggtccgggctggcgctcaaggtgcaggagcagcaccggcagaaacac
tttgagaaaaggaggaagccagcggcggagctcattcaggctgcctggcggtactatgcc
accaaccccaacaggatcgaccttgtggcgacatggaggttctatgagtcagtcgtctcc
tttccgttcttcaggaaagaacagctggaggcagcagccagccaaaagctgggtctcttg
gatcgggttcgcctttctaatcctcgtggtagcaatactaaaggaaagctatttacccct
ctgaatgtagatgccatagaagaaagtccttctaaagagccaaagcctgttggcttaaac
aataaagagcgtttccgcaccgccttccgcatgaaagcctacgctttctggcagagctcc
gaagatgctgggacgggcgagcccatggcagaagacagggactacgggaatgacttcctc
gtcgaagacatgatccccaccctgaaggctgccatccgagctgtcagaattttacaattc
cgtctctataaaaagaaattcaaggagactttgaggccttacgacgtgaaggatgtgatt
gagcagtattccgcagggcatctcgacatgctctccaggatcaagtaccttcagaccaga
atagatatgattttcacccccggaccaccatctactccaaaacataagaagcctcagaaa
ggggcagcgttcacttacccgccccagcagtctcccaggaatgaaccgtatgtagccagg
gcatccacttcagaaatggaagaccaaagcatgatggggaagtttgtgaaagtcgagaga
caggtccacgacatggggaggaagctggatttcctggtggatatgcacatgcaacacatg
gagaggctgcaggtgcacgtcaccgactacgaccccaccaagggggcctcaccggccgag
gtggagcggagaggggacagcagggatcctgacttgagaagcatcatttgcaactattct
gagacaggcgcccccgatgcctcctacagcttccaccaggtgcccatggacaaagtcggc
ccctacaggttctctgcccacgacccagtgagcctgccccgagggggacccggccctgga
aggggtcaggcggcccttccttcctccgcggcggcgcatgtggagcggcccaccgtcctg
cccatcctgacgcttctcgactcccggctgagccgccagtccccggccgacccgcacggc
ccctgctcggacagggtctccccccggcagagacgcagcttcacgcgggacagcgacacg
cccctgtccctgatgtccgtggaccacgaggagctggaacggtctccaagtggcttcagc
atctcccaagacagagacgacgtgtttggcccgagcgggggctcgagctggatgagggag
aagcgatacctcgccgagggtgagacagacacggacacagaccccttcacacccagtggc
tccatgcctctgtcatccacaggggacgggatttctgattcgatatggacccctcccagc
aaacccatttaa

KEGG   Miniopterus natalensis: 107539908
Entry
107539908         CDS       T05883                                 

Gene name
KCNQ1
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04725  Cholinergic synapse
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107539908 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    107539908 (KCNQ1)
   04972 Pancreatic secretion
    107539908 (KCNQ1)
   04974 Protein digestion and absorption
    107539908 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    107539908 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107539908 (KCNQ1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107539908 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP
Other DBs
NCBI-GeneID: 107539908
NCBI-ProteinID: XP_016072000
LinkDB
Position
Unknown
AA seq 570 aa
MGPCGPGAATHSIVSSWDCGWHGECFLIVLVCLIFSVLSTIEQYVALATGTLFWMEIVLV
VFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFAT
SAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAE
KDAVNEAGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPA
GILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARGHA
LLSPSPKPKKSAMVKKKKFKLDKDNGVSPGEKMLTVPHITYDPVSEERRLDHFSVDSYEG
SVKKRPTVLEVSATHFTRTNSFTEDLDLEGETLLTPITHVSQLREHHRATIRVIRRMQYF
VAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDR
GSNTIGARLGRLEDKVTQLDQRLILITDMLHQLLSLHQSGPPGGRPPSGGGAHLVQPCRG
PIDPELFLPSNALPTYEQLTVPHRGPDEGS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggccctgtggccctggggctgccacccactccatcgtgagcagctgggactgtggc
tggcacggggaatgcttcctcatcgtcctggtgtgcctcatcttcagtgtgctgtccacc
atcgagcagtacgtcgccctggccacggggaccctcttctggatggagattgtcctggtc
gtgttcttcgggacagagtatgtggtccgcctctggtcagccggctgccgcagcaagtac
gtgggcatctgggggcggctgcgctttgcccggaagcccatttccatcatcgacctcatc
gtggttgtggcctccatggttgtcctctgcgtgggatccaaagggcaggtgtttgccacc
tcggccatcaggggcatccgcttcctgcagatcctgcggatgctgcacgtggaccgccag
ggcggcacctggaggctgctgggctccgtggtcttcatccaccgccaggagctgatcacc
accctgtacattggcttcctgggcctgatcttctcttcttacttcgtgtacttggccgag
aaggacgccgtgaacgaggctggacgcgtcgagtttggcagctatgcggacgccctgtgg
tggggagtggtcacggtcaccaccatcggctacggggacaaggtgccccagacgtgggtc
gggaagaccatcgcctcttgcttctccgtgttcgccatctccttctttgcgctcccggcg
gggatcctgggctccgggttcgccctgaaggtccagcagaagcagcggcagaagcatttc
aaccggcagatccccgcggcggcctcgctcatccagacggcatggaggtgctatgccgcc
gagaaccctgactcggccacctggaaaatctacgtgcggaagccagcccggggccacgct
ctgctctcccccagccccaagcccaagaaatctgccatggtaaagaaaaaaaagttcaaa
ctggacaaagacaacggggtgagtccgggcgagaagatgctcaccgtcccccacatcacc
tacgaccccgtctcggaggagcggaggctggaccacttctcggtggacagctacgagggt
tctgtgaagaaacgccccacggtgctggaggtgagcgccacccacttcacgaggaccaac
agcttcactgaggacctggacctggagggggagacactgctgacccccatcacccacgtg
tcgcagctgcgggagcaccaccgggccaccatccgggtcattcggcgcatgcagtacttc
gtggccaagaagaaattccagcaagcgcggaagccctacgacgtgcgggacgtcatcgag
caatactcgcagggccacctcaacctcatggtgcgcatcaaagagctgcagagaaggctg
gaccaatccatcgggaagccctccctcttcatctccgtctcagaaaagagcaaggaccgc
ggcagcaataccatcggcgcccgcctgggccggctggaagacaaggtgacacagctggac
cagcggctgattctcatcacagacatgctccaccagcttctctctctgcaccagagcggc
ccccccggcggccggccccccagcggaggtggcgcccacctggtccagccctgccgaggc
cccatcgaccccgagctcttcctgcccagcaatgcactgcccacctacgaacagctgacc
gtgccccacaggggccccgacgaggggtcctga

KEGG   Miniopterus natalensis: 107542216
Entry
107542216         CDS       T05883                                 

Gene name
KCNJ12
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 12
  KO
K05005  potassium inwardly-rectifying channel subfamily J member 12/18
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107542216 (KCNJ12)
  09156 Nervous system
   04725 Cholinergic synapse
    107542216 (KCNJ12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107542216 (KCNJ12)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107542216 (KCNJ12)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 MFS_1 DUF92
Other DBs
NCBI-GeneID: 107542216
NCBI-ProteinID: XP_016074959
LinkDB
Position
Unknown
AA seq 428 aa
MTAATRANPYSVVSSEEDGLHLVTMSGTNGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEDRSR
TPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGRLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVESKFLLPSTNSFCYENELAFMSPDEGDETDDDQDSSRPPAGHDFPRPQTCGGALAQR
PYRRESEI
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgactgcagccacccgggccaacccctatagcgttgtgtcatctgaggaggacgggctg
cacctggtcaccatgtcgggcaccaatggctttggcaatggcaaggttcacacgcggcgc
aggtgccgaaaccgctttgtcaaaaagaatggccagtgcaacattgagttcgccaacatg
gatgagaagtcgcagcgctacttggctgacatgttcaccacctgtgtggacatccgctgg
cgctacatgctgctcatcttctccctggccttcctcgcctcctggctactgtttggtgtc
attttctgggtcattgctgtggcccacggagacctggagccggctgaggaccgcagccgc
acgccctgtgtcttgcaggtccatggcttcatggcagccttcctcttctccattgaaacg
caaaccaccattggctacgggctgcgctgcgtgacagaggagtgcccagtggctgtcttc
atggtggtggcacagtccatcgtgggctgcatcatagattccttcatgatcggtgccatc
atggccaagatggccaggcccaagaagcgggcgcagacactgttgttcagccacaacgct
gtggtggcgctgcgcgacggcaggctttgcctcatgtggcgtgtgggcaacctgcgaaag
agccacattgtggaggcccatgtgagggctcagctcatcaagccaagggtcacggaagag
ggcgagtacatcccgctggaccagatcgacattgacgtgggctttgacaagggcctcgat
cgcatcttcttggtgtcgcccatcaccatcctgcatgagatcgacgaggccagcccgctg
ttcggcatcagccggcaggacctggagacagacgactttgagattgtggtcatcctggag
gggatggtagaggccacagccatgaccacacaagcccgtagctcctacctggccaacgag
atcttgtggggccaccgcttcgagcctgtcctctttgaggagaagaaccagtacaagatt
gactactcacacttccacaagacctacgaggtgccctccaccccccgctgcagtgccaag
gacctggtggagagcaagttcctgctgcccagcaccaactccttttgctatgagaatgag
ctggccttcatgagtcctgacgagggggacgaaacggatgacgaccaagacagcagccgc
cctccggctggacacgacttccccagaccccagacttgcggcggcgccctggcgcagcgg
ccctaccggcgggagtcggagatctga

KEGG   Miniopterus natalensis: 107545171
Entry
107545171         CDS       T05883                                 

Gene name
KCNJ4
Definition
(RefSeq) inward rectifier potassium channel 4
  KO
K04998  potassium inwardly-rectifying channel subfamily J member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107545171 (KCNJ4)
  09156 Nervous system
   04725 Cholinergic synapse
    107545171 (KCNJ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107545171 (KCNJ4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107545171 (KCNJ4)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF92 IRK_N
Other DBs
NCBI-GeneID: 107545171
NCBI-ProteinID: XP_016078730
LinkDB
Position
Unknown
AA seq 443 aa
MLGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPVVATAGAPVGSGGAAPVTPKPCIMHVNGF
LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR
AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD
LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT
QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL
PAPPPPPSAFCYENELALLSQEEEELEEEAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSH
LDLERMQATLPLDNISYRRESAI
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctcgggcacagccgcaacgggcaggcccacgtgccccggcggaaacgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtctacttcgccaacctgagcaacaagtcgcag
cgctacatggcggacatcttcaccacctgcgtggacacgcgctggcgctacatgctcatg
atcttctccgcggccttcctcgtctcctggctcttctttggcctcctgttctggtgcatc
gcgttcttccacggtgacctggaggccagcccagtggtggccacggcgggggcccccgtg
ggcagcggcggggcggccccagtgacccccaagccatgcatcatgcacgtgaacggcttc
ctgggcgccttcctgttctcggtggagacgcagacgaccatcggctacgggttccggtgc
gtgacggaggagtgcccgctggcggtcattgccgtggtcgtccagtccatcgtgggctgc
gtcattgactccttcatgatcggcaccatcatggccaagatggccaggcccaagaagcgg
gcgcagacactgctgttcagccaccacgcggtcatctcggtgcgtgacggcaagctctgc
ctgatgtggcgcgtgggcaacctgcgcaagagccacatcgtggaggcccacgtgcgggcc
cagctcattaagccctacatgacccaggagggcgagtacctgccgctggaccagcgggac
ctcaacgtgggctatgacattggcctggaccgcatcttcctggtgtcgcccatcatcatc
gtccacgagatagatgaggacagccccctgtacggcatgggcaaggaggagctggagtcc
gaggactttgagatcgtggtcatcctcgagggcatggtggaggccacagccatgaccacc
caggcccgcagctcctacctggccagcgagatcttgtggggccaccgcttcgagcccgtg
gtcttcgaggagaagagccactacaaggtggactactcgcgcttccacaagacctacgag
gtggccggcacgccctgctgctccgcccgggagctgcaggagagcaagatcacggtgctg
cccgccccgccccccccgcccagtgccttctgctacgagaacgagctggccctgctgagc
caggaggaggaggagctggaggaggaggcggccgcggcggccgtggccgcaggcctgggc
ctggaggcaggctccaaggaggaggcgggcatcatccggatgctcgagttcggcagccac
ctggacctggagcgcatgcaggccaccctcccgctggacaacatctcctaccgtagggag
tcggccatctga

DBGET integrated database retrieval system