KEGG   Miniopterus natalensis: 107528394
Entry
107528394         CDS       T05883                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04218  Cellular senescence
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05145  Toxoplasmosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528394 (MAP2K6)
   04015 Rap1 signaling pathway
    107528394 (MAP2K6)
   04668 TNF signaling pathway
    107528394 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107528394 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107528394 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    107528394 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107528394 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    107528394 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107528394 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528394 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107528394 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107528394 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    107528394 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107528394 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528394 (MAP2K6)
   05135 Yersinia infection
    107528394 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107528394 (MAP2K6)
   05161 Hepatitis B
    107528394 (MAP2K6)
   05163 Human cytomegalovirus infection
    107528394 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528394 (MAP2K6)
   05169 Epstein-Barr virus infection
    107528394 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107528394 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107528394 (MAP2K6)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107528394 (MAP2K6)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107528394 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 CLP1_P DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 107528394
NCBI-ProteinID: XP_016056957
LinkDB
Position
Unknown
AA seq 366 aa
MPIPSPGCLRPVLLTNWLQTGGSQEPCLDFRLPVIGPGKKRNPGLKIPKEAFEQPQTSST
PPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRATV
NSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQ
TIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGHLVDSV
AKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLK
QVVEEPSPQLPADKFSEEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKATDVASFV
KLIVGD
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgccaattccaagtccaggttgtttgcgacctgtgcttctgaccaactggctacagact
ggaggttcccaggaaccctgtttggacttcagactcccagtcataggtccaggcaagaag
cgaaaccctggccttaaaatcccaaaagaagcatttgagcaacctcagaccagttccacg
cctcctcgagatttagactctaaagcttgcatttctattggaaatcagaactttgaggtg
aaggcagatgacctggagcctatagtggaactgggacgaggtgcgtacggggtggtggag
aagatgcggcatgtgcccagcgggcagatcatggcggtgaagcggatccgggccacagta
aacagccaggagcagaaaaggctactgatggacttggatgtttccatgaggaccgtggac
tgcccttttacggtcaccttttatggcgcactcttccgggagggtgatgtctggatctgc
atggagctcatggatacatcgctagataaattctacaaacaagtgatcgataaaggccaa
acaattccagaggacatcttagggaaaatagcagtttctattgtaaaagcgttagaacac
ttacacagtaagctgtcggtcatccatcgagacgtcaagccctccaacgtgctcatcaac
accctgggccaagtgaagatgtgcgatttcggcatcagtggccaccttgtcgactcagtt
gctaaaacgatcgatgcaggatgcaaaccatacatggctcctgaaagaataaaccccgag
ctcaaccagaagggatacagtgtgaagtctgacatttggagtctgggcatcacaatgatc
gagttggccatccttcggtttccctacgactcatgggggactccttttcagcagctcaaa
caggtggtcgaggagccatcgccacagctcccagcagacaaattctccgaagagttcgtg
gactttacctcacagtgcttgaagaagaattccaaagaacggccgacgtatccagaactt
atgcaacatccatttttcaccctacacgaatccaaagcaacagacgtggcatcttttgta
aaactgattgttggagactag

KEGG   Miniopterus natalensis: 107542219
Entry
107542219         CDS       T05883                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04015  Rap1 signaling pathway
mna04218  Cellular senescence
mna04620  Toll-like receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04750  Inflammatory mediator regulation of TRP channels
mna04912  GnRH signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05145  Toxoplasmosis
mna05161  Hepatitis B
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107542219 (MAP2K3)
   04015 Rap1 signaling pathway
    107542219 (MAP2K3)
   04668 TNF signaling pathway
    107542219 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107542219 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107542219 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    107542219 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107542219 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    107542219 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107542219 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107542219 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107542219 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107542219 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    107542219 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542219 (MAP2K3)
   05135 Yersinia infection
    107542219 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107542219 (MAP2K3)
   05161 Hepatitis B
    107542219 (MAP2K3)
   05169 Epstein-Barr virus infection
    107542219 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107542219 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542219 (MAP2K3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107542219 (MAP2K3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107542219 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DHR-2
Other DBs
NCBI-GeneID: 107542219
NCBI-ProteinID: XP_016074964
LinkDB
Position
Unknown
AA seq 311 aa
MGSPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIR
ATVNSQEQKRLLMDLDVNMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLD
KGMMIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLV
DSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQ
QLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIA
AFVKEILGEDP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggaagcccccccagaaacctggactcacggaccttcatcaccatcggagacaggaac
tttgaggtggaggctgatgacctggtgaccatttcggagctaggtcgcggagcctatggg
gtggtggagaaggtacgacacgcccagagtggcaccatcatggctgttaagcggatccgg
gccaccgtgaactcacaggagcagaagcgtctgcttatggacttggacgtcaacatgcgc
acagttgactgcttctacactgtcaccttctatggggccctcttcagagagggagatgtg
tggatctgcatggaactcatggacacatccctggacaagttctaccgtaaggtgctcgat
aaaggcatgatgattccagaagacattctgggggagattgctgtttctattgtgagggca
ctggagcacctgcacagcaagctgtcggtgattcacagagatgtgaagccatctaatgtc
ctcatcaacaaggaggggcacgtgaagatgtgtgactttgggatcagcggctacttggtg
gattctgtggccaagacgatggatgctggctgcaagccctacatggcccctgagagaatc
aacccggagctgaaccagaagggctacaatgtcaagtccgacgtctggagccttggcatc
accatgattgagatggctattctgcgttttccttatgagtcctgggggaccccgttccag
cagctgaagcaggtggtggaggagccgtccccccagctcccagctgaccgtttctctcct
gagtttgtggacttcactgcacagtgcctgaggaagaaccccgcagagcgcatgagctac
ctggagctgatggagcatcctttcttcaccttgcacaaaaccaagaagacggacatcgca
gcgttcgtgaaggagatcctgggagaggacccatag

KEGG   Miniopterus natalensis: 107544551
Entry
107544551         CDS       T05883                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04620  Toll-like receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04912  GnRH signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544551 (MAP2K4)
   04012 ErbB signaling pathway
    107544551 (MAP2K4)
   04668 TNF signaling pathway
    107544551 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107544551 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    107544551 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107544551 (MAP2K4)
   04926 Relaxin signaling pathway
    107544551 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    107544551 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107544551 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544551 (MAP2K4)
   05135 Yersinia infection
    107544551 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544551 (MAP2K4)
   05161 Hepatitis B
    107544551 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544551 (MAP2K4)
   05169 Epstein-Barr virus infection
    107544551 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107544551 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544551 (MAP2K4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107544551 (MAP2K4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107544551 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 107544551
NCBI-ProteinID: XP_016077942
LinkDB
Position
Unknown
AA seq 281 aa
MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICM
ELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLD
RSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLY
ELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKY
KELLKHPFILMYEERTVEVASYVCKILDQMPTTPSSPMYVD
NT seq 846 nt   +upstreamnt  +downstreamnt
atggtccacaaaccgagtggacagataatggcagtgaaaagaattcggtcaacagtggat
gaaaaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgc
ccatacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatg
gaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgat
gttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccac
ttaaaagaaaacttgaaaatcattcacagagatatcaaaccttccaatatccttctggac
agaagtggaaatattaaactctgtgactttggcatcagtggacagctcgtggattccatt
gccaagacaagagatgctgggtgtaggccgtacatggcaccggagagaatagacccgagt
gcgtcacgacaaggctatgatgtccgctctgatgtctggagtttggggatcacactgtac
gagttggccacaggccggtttccttatccaaagtggaatagtgtatttgatcaactaaca
caagtcgtgaaaggagatcctccacaactgagtaattcagaggaaagggagttctctcca
agtttcatcaactttgtcaacttgtgccttacaaaggacgaatccaaaaggccaaagtat
aaagaacttctgaaacatccctttattttaatgtatgaagaacgtaccgtagaggttgca
agctatgtttgtaaaatcctggatcaaatgccaactactcccagctcccccatgtatgtc
gattga

DBGET integrated database retrieval system