KEGG   Miniopterus natalensis: 107528423
Entry
107528423         CDS       T05883                                 

Gene name
MAD2L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2A
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107528423 (MAD2L1)
   04114 Oocyte meiosis
    107528423 (MAD2L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107528423 (MAD2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528423 (MAD2L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107528423 (MAD2L1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107528423 (MAD2L1)
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2
Other DBs
NCBI-GeneID: 107528423
NCBI-ProteinID: XP_016056980
LinkDB
Position
Unknown
AA seq 185 aa
MKCGPFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPELMKYLNNVVEQLKDWLYKCS
VQKLVVVISNIENGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT
FLPLLEVSCSFDLLIYTDKDLIVPEKWEESGPQFITNSEQVRLRSFTTTIHKVNSMVAYK
IPVND
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaaatgtggcccatttggcatcaacagcattttatatcagcgtggcatttatccctct
gaaacctttactcgagtgcagaaatacggactcaccttgcttgtgaccactgatcccgag
ctcatgaagtacctgaacaatgtggtggagcaactgaaagactggctgtacaagtgttca
gtgcagaagctggtggtagtcatctcgaacattgagaacggggaggtccttgaaaggtgg
cagtttgatattgagtgtgacaagactgccaaagatgacagtgcgcccagagaaaagtct
cagaaagcaatccaagacgagatccgctccgtgatcaggcagatcacagctaccgtgacc
tttctgccactgctggaagtgtcttgttcattcgatctgctgatctatacggacaaagat
ttgattgtacctgaaaagtgggaagagtcaggaccacagttcattaccaattctgagcag
gtccgtctgcgttccttcacgactacaatccacaaagtgaacagcatggtggcctacaaa
atccctgtcaatgactga

KEGG   Miniopterus natalensis: 107537043
Entry
107537043         CDS       T05883                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107537043 (MAD1L1)
   04114 Oocyte meiosis
    107537043 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107537043 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107537043 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107537043 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107537043 (MAD1L1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107537043 (MAD1L1)
SSDB
Motif
Pfam: MAD DUF4200
Other DBs
NCBI-GeneID: 107537043
NCBI-ProteinID: XP_016068452
LinkDB
Position
Unknown
AA seq 716 aa
MEDLGENTTVLSSLRSLNNFISQRVDGGAGLDVSTSAPGSLQMQYQQSMQLEERAEQIRS
KSHIIQVEREKMQMQLSHKRARVELERAASTSARSYEREVDRNQELLTRIRQLQDREAEA
EEKMKEQLERNRQCKQSLDAANRRLQEKEDGLAEAGETISELKNRISELQWSVMNQEMQV
KGLESEKQELQEQLDLQRRKCQEADQKIQELQASQETRADQEQRIKDLEQKLFLQEQDSV
IVKNMKSELVRLPKMERELKQLKEENAYLREMRETNGLLREEVEGLQRKLSRQEKMQENL
VDLELEKERLLAKLQSWERLDQTTGLSIRTPEDLSRFIVELQQRELALKDRNGSITSSAR
ELDKVRQQLQEEVCQVSAQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEYSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQALEELGGQKQRADMLEMELKVL
RSQSGPAEQSVLLSREEVSELRLKVEELEGERGRLEEEKRRLEAQLEHLTLQGDYDQSKT
KVLHMSMNPASEAQQSRRQDQMRLQEECERLRKLVCALERGGPVPADLEATCLPSSKEVA
ELRKQVESAELRNQRLKEVFQTKVQEFRKVCYTLTGYQVDITRESQYRLTSMYAEHKDDC
LVFKATGPSGTTMQLLETEFSRTVPELIELHLLRQDSIPAFLSALTLDLFSRQTLA
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggaagacctgggggaaaataccactgtcctgtcctccctgaggtctttgaacaacttc
atttctcagcgagtggacggaggagctggactggatgtttccacctctgccccaggttct
ctgcagatgcagtaccagcagagcatgcagttggaagagcgagcagagcagatccggtcg
aagtctcacatcatccaggtggagcgtgagaagatgcagatgcagctgagtcacaagagg
gctcgcgtggagctggagcgagcggccagcaccagtgcccgtagctacgagcgtgaggtg
gaccggaaccaagagctcctgacacgaattcggcagcttcaggaccgcgaggcggaggcg
gaggagaaaatgaaggagcagctggagcgcaataggcagtgtaagcagagcctggacgcc
gccaacaggaggctgcaggagaaggaggatggcctggccgaggccggcgagaccatcagc
gaattaaagaacaggatctcggaactgcagtggagtgtaatgaaccaggagatgcaggtg
aagggcctggagtctgagaagcaggagctgcaggagcagctggacctgcagcgtagaaaa
tgtcaggaagccgatcagaagattcaggaactccaggccagccaagaaacaagggcagac
caggagcagaggatcaaggatttggagcagaagctgttcctgcaggagcaggattctgtg
attgtgaagaacatgaagtctgagctggtgcgattgcccaagatggagcgggagctgaag
cagctgaaggaagagaatgcctacctgcgggagatgcgagagaccaacgggctgctcagg
gaagaagtggaggggctgcagcggaagctgagccgtcaggagaagatgcaggaaaatttg
gttgacctggagctggagaaggagaggctgctggcgaagctgcaaagctgggagagactg
gaccagaccacgggcctgagcatcaggacacccgaagacctctccaggttcatcgtagag
ctacagcagcgggagctggccctgaaggacaggaacggctccatcaccagcagtgcccgg
gagctggacaaggtcaggcagcagctccaggaagaggtgtgccaggtcagcgctcagctg
ctggaggagaggaagaagcgtgagacacacgaggccctggcccggaggcttcagaagcgg
gtcctgctgctgaccaaggagcgggacggcatgcgcgccatcctggggtcctacgacagt
gagctgacgccagccgagtactcgccccaactgacccgacgcatgcgcgaggccgaggac
atggttcagaaggtgcacgcccacagttctgagatggaggctcaactgtcccaggcgctg
gaggaactgggcggccagaagcagagggcagacatgctggagatggagctgaaggtgctg
cggtcccagtcgggccctgccgagcagagcgtcctgctgtccagggaggaggtgagcgag
ctcaggttgaaggtggaggagctggaaggggagcggggccgtctggaggaggagaagagg
cgtctggaagcgcagctggagcacctcaccctgcagggcgactatgaccagagcaagacc
aaggtgctgcacatgagcatgaacccggccagcgaggcacagcagagccgccgccaggac
cagatgcggctgcaggaggagtgcgagaggctgcggaagctggtgtgcgccctggagagg
ggcggccctgtgcctgccgacctggaggccacgtgcctgccctcgtccaaggaggtggca
gagctgaggaagcaggtggagagcgcggagctgagaaaccagcggctcaaggaggtcttc
cagaccaaggtccaggagttccggaaggtgtgctacacgctcacgggctaccaggtggac
atcactagggagagccagtaccggctgacgtccatgtacgccgagcacaaggatgactgc
ctggtcttcaaggccacaggaccctcgggcaccaccatgcagctgctggagacggagttc
tcgcggacggtgcccgagctcatcgagctgcacctgctgcgccaggacagcatccccgcc
ttcctcagcgccctcaccctcgacctcttcagccgccagaccctggcctag

KEGG   Miniopterus natalensis: 107540988
Entry
107540988         CDS       T05883                                 

Gene name
MAD2L2
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
mna05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107540988 (MAD2L2)
   04114 Oocyte meiosis
    107540988 (MAD2L2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107540988 (MAD2L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107540988 (MAD2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107540988 (MAD2L2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107540988 (MAD2L2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 107540988
NCBI-ProteinID: XP_016073374
LinkDB
Position
Unknown
AA seq 197 aa
VADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPL
LEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCD
AVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTS
DILKMQLYVEERAHKSS
NT seq 596 nt   +upstreamnt  +downstreamnt
tggtggccgacgtgctctgcgaattcctggaggtggcggtgcacctgatcctctacgtgc
gcgaggtctacccggtgggcatcttccagaagcgtaagaagtacaacgtgcctgtccaga
tgtcctgccacccggagctgaaccagtatatccaggacacgctgcactgtgttaagccgc
tcctggagaagaatgacgtggagaaggtggtggtggtaattttggacaaagagcaccgcc
cagtggagaaattcgtctttgaaatcacccagcctccgctgctgtccatcagctcagact
cgctgctgtctcatgtggagcagctgctccgagctttcatcctgaagatcagtgtgtgtg
atgctgtcctggaccacaaccccccaggttgtaccttcacagttttggtgcacacgaggg
aagctgccactcgcaacatggagaagatccaggtcatcaaggacttcccctggatcctgg
cagacgagcaggatgtccacatgcatgacccccggctcatacccctcaaaaccatgacgt
cggacattctaaagatgcagctctacgtggaagaacgagctcataaaagcagctga

DBGET integrated database retrieval system