KEGG   Miniopterus natalensis: 107528428
Entry
107528428         CDS       T05883                                 

Symbol
CANX
Name
(RefSeq) calnexin
  KO
K08054  calnexin
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04145  Phagosome
mna04612  Antigen processing and presentation
mna04918  Thyroid hormone synthesis
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528428 (CANX)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107528428 (CANX)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107528428 (CANX)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107528428 (CANX)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528428 (CANX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107528428 (CANX)
   04131 Membrane trafficking [BR:mna04131]
    107528428 (CANX)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107528428 (CANX)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   107528428 (CANX)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    107528428 (CANX)
Lectins [BR:mna04091]
 Calnexin / calreticulin
  107528428 (CANX)
SSDB
Motif
Pfam: Calreticulin Connexin MAP17 FAM176 TRAP_alpha DUF6080
Other DBs
NCBI-GeneID: 107528428
NCBI-ProteinID: XP_016056988
LinkDB
Position
Unknown
AA seq 592 aa
MGEKWLLCLLLVLGIAVIRAHEGHDDDVIDIEDDLDDVIEEVEDSKTKPETSTPQSPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKSPDLNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSLVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVADPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIICGDRRVVDDWASDGWGLKKAADGAAEPGVVGQMLEAAEE
RPWLWVVYVLTVALPVFLVILFCCSGKKQPSPVEYKKTDAPQPDVKEEEEEKEEERDKAD
EEDSEEKLEEKQKSDAEEDGDAVSQEVEDRKPKAEEDEILNRSPRNRKPRRE
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggagagaagtggttgctgtgtttgttactagtccttggaattgctgtcattcgggct
catgagggccatgacgatgatgtgattgatattgaggatgacctcgatgatgtcattgaa
gaggtagaagactcaaaaacgaaaccagagaccagcactcctcagtctccaaaggtcacc
tacaaagctccagttccaacaggggaagtgtattttgctgattcctttgacagaggaact
ctgtctgggtggattttatccaaagccaagaaagatgatactgatgatgaaattgccaaa
tatgatggaaaatgggaggtagatgaaatgaaggaaacaaagcttccaggtgacaaagga
ctcgtattgatgtctcgggccaagcatcatgccatctctgctaaactgaacaagcccttc
ctgtttgataccaagcctctcattgttcagtatgaagttaatttccaaaatggaatagaa
tgtggtggtgcctatgtgaaactgctttccaaaagcccagatctcaacttggaccagttc
catgacaagaccccttatacaatcatgtttggtcccgataaatgtggagaagactataaa
ttgcacttcatcttccgtcacaaaaaccccaaaacgggtgtatacgaagaaaagcacgct
aagaggccagatgcagatctgaagacctattttactgataagaaaacacacctttataca
ttaatcttgaatccagataatagttttgaaatattagtggaccaatctcttgtgaacagt
ggaaatctcctaaatgacatgactcctcctgtaaatccttcacgtgaaattgaggaccca
gaagaccggaaacctgaggattgggatgaaagaccaaaaataccagatcctgatgctgtc
aaaccagatgactgggatgaagatgcccctgctaaaattcccgatgaagaagccacaaag
ccggaaggctggttagatgatgagcccgaatatgtagctgatccagatgcggaaaagcca
gaggattgggatgaagatatggatggagaatgggaggctcctcagattgccaaccctaag
tgtgagtcggcccctgggtgtggcgtctggcagcgacctatgattgataaccctaattat
aagggcaaatggaagccccccatgattgacaaccctaactaccagggaatctggaaaccc
aggaaaataccaaatccagatttctttgaagatctagaacctttcaaaatgactcctttt
agtgctattggtttggaactgtggtccatgacctcagacattttctttgacaactttatc
atttgtggtgatcgaagagtagttgatgattgggccagtgatggatggggtctgaagaaa
gctgctgatggagctgctgagccaggtgtagtggggcagatgctggaggcagctgaggag
cgcccatggctctgggtggtctacgtcttgactgtagcgctgcctgtgtttctcgtaatc
ctcttctgctgttctggaaagaaacagcccagccctgtggagtacaagaagacggatgct
cctcagcccgatgtgaaggaggaggaggaagagaaggaggaagaaagggacaaggcggat
gaggaggacagcgaagagaaactggaagagaagcaaaaaagtgatgctgaagaagatggt
gacgctgtcagtcaagaggttgaagataggaaacctaaagcagaggaggatgaaattttg
aacagatcaccaagaaacagaaagccgagaagagagtga

DBGET integrated database retrieval system