KEGG   Miniopterus natalensis: 107528485
Entry
107528485         CDS       T05883                                 

Gene name
TRPV4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04218  Cellular senescence
mna04750  Inflammatory mediator regulation of TRP channels
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107528485 (TRPV4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107528485 (TRPV4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107528485 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528485 (TRPV4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   107528485 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 107528485
NCBI-ProteinID: XP_016057053
LinkDB
Position
Unknown
AA seq 872 aa
MADPGEGPRPGPGEAAEPPGDESGTPGGEAFPLSSLANLFEGEDGSPLPSPPDAGRPAAG
SGDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSD
NKRWRRKVLEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLPYLLTHKKR
LTDEEFREPSTGKTCLPKALLNLNNGRNDTIPLLLDIAERTGNMREFINSPFRDIYYRGQ
TALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPH
IVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPD
SNLEAVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLY
DLSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYL
CAMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEIITLFTGVLFFFTNIKDLFMKKCPG
VNSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLT
GTYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKECSEGRANCTVPTYPS
CRDSDTFSTFLLDLFKLTIGMGDLEMLSSTKYPAVFIILLVTYIILTFVLLLNMLIALMG
ETVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFR
VDEVNWSHWNQNLGIINEDPGKNESYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPD
EVVVPLDNMGNPSCDGHQQSYPPKWRTDDAPL
NT seq 2619 nt   +upstreamnt  +downstreamnt
atggcagaccccggcgaaggcccccgcccggggcccggggaggcggccgagccccccggg
gacgagagcggcaccccgggtggcgaggccttccccctgtcgtcgctggccaacctgttt
gagggagaggacgggtcccccttgccctcgccgcccgacgctggtcgccctgccgcgggc
tcgggcgatgggcgaccaaacctgcgcatgaagttccagggcgccttccgcaagggggtg
cccaaccccattgacctgctggagtccaccctgtatgagtcctcggtggtgccggggccc
aagaaggcccccatggattcgctctttgactacggcacctatcgccaccaccccagcgac
aacaaacggtggaggaggaaggtcttggagaagcagccgcagagccccaaagctcctgca
ccccagccgccccccatcctcaaagtcttcaaccggcccatcctcttcgacatcgtgtcc
cggggctctactgccgacctggacgggctgctcccctacctgctgacccacaagaagcgc
ttgactgacgaggagttccgggaaccgtccactgggaagacctgcctgcccaaggccctg
ctgaacttgaacaacggccgtaatgacaccatccccttgcttctggacatcgctgagcgc
accggcaacatgcgcgagttcatcaactcgcccttccgagacatctactaccgaggtcag
accgccctgcacattgccatcgagcgtcgctgcaaacactacgtggagctcctcgtggcc
cagggagccgatgtccatgcccaggcccgggggcgcttcttccagcccaaggatgaggga
ggctacttctacttcggtgagctgcccctgtcgctggctgcctgcaccaaccagccccac
atcgtcaactacctgacggagaacccccataagaaggcggacatgcggcggcaggactcc
cggggcaacacggtgctgcacgccctggtggccatcgccgacaacacccgcgagaacacc
aaattcgtcaccaagatgtacgacctcctgctgctcaagtgtgcccgcctcttccccgac
agcaacctggaggctgtgctgaacaacgatggcctctcacccctcatgatggccgccaag
acgggcaagattggggtctttcagcacattatccggcgggaggtgacggatgaagacacc
agacacttgtcccgcaagttcaaggactgggcctacggacccgtttattcctcgctctat
gacctctcctccctggacacgtgtggggaagaggcctcggtgctggagatcctggtgtac
aacagcaagatcgagaaccgccacgagatgctggccgtggagcccatcaacgagctgctg
cgggacaagtggcgcaagttcggggctgtctctttctacatcaacgtggtctcctatcta
tgtgccatggtcatcttcaccctgaccgcctactaccagccgctggagggcaccccgcca
tacccataccgcaccacggtggactacctgaggctggccggcgagatcatcacgctcttt
accggggtcctgttctttttcaccaacatcaaagacttgttcatgaagaaatgccctgga
gtgaattctctcttcatcgatggctccttccagctactctacttcatctactccgtgctg
gtgattgtctcggcggccctctacctggcggggatcgaggcttacctggccgtcatggtc
tttgccttggttctgggctggatgaatgccctttacttcacacgcgggctgaaactaaca
gggacctacagcatcatgatccagaagatactcttcaaagacctgttccgcttcctgctg
gtctacttgcttttcatgatcggctacgcatcagccctggtgtccctgctgaacccgtgc
gccaacatgaaggagtgcagcgagggccgcgccaactgcacggtgcccacctacccctcg
tgccgtgacagcgacaccttcagcaccttcctcctggacctcttcaagctgaccatcggc
atgggcgacctggagatgctgagcagcaccaagtaccccgcggtgttcatcatcctgctg
gtcacctacatcatcctcaccttcgtgctgctgctgaacatgctcatcgccctcatgggg
gagacggtcggccaggtctccaaggagagcaagcacatctggaagctgcagtgggccacc
accatcctggacatcgagcgctccttccccgtgttcctgaggaaggccttccgctctggc
gaaatggtgactgtgggcaagagctcggacggcaccccagaccgcaggtggtgcttcagg
gtggacgaggtgaactggtctcactggaaccagaacttgggcatcattaacgaggaccct
ggcaagaacgagagctaccagtactacggcttctcgcacacagtgggccgcctccggagg
gatcgctggtcctcggtggtgccgcgtgtggtggaactgaacaaaaactcgaacccagat
gaggtggtggtgcctctggacaacatggggaaccccagctgcgacggccaccagcagagc
tatccccccaaatggaggactgatgacgcccccctctag

DBGET integrated database retrieval system