KEGG   Miniopterus natalensis: 107528505
Entry
107528505         CDS       T05883                                 

Gene name
PXN
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
mna  Miniopterus natalensis
Pathway
mna04062  Chemokine signaling pathway
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107528505 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107528505 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107528505 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107528505 (PXN)
   04062 Chemokine signaling pathway
    107528505 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107528505 (PXN)
   05203 Viral carcinogenesis
    107528505 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107528505 (PXN)
   05100 Bacterial invasion of epithelial cells
    107528505 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107528505 (PXN)
   05163 Human cytomegalovirus infection
    107528505 (PXN)
   05165 Human papillomavirus infection
    107528505 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107528505 (PXN)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 LIM domain-containing proteins
  Paxillin family proteins
   107528505 (PXN)
SSDB
Motif
Pfam: Paxillin
Other DBs
NCBI-GeneID: 107528505
NCBI-ProteinID: XP_016057086
LinkDB
Position
Unknown
AA seq 487 aa
MSSSLGSNLSELDRLLLELNAVQHNPPGFPADETNSSPPLPGALSPHYGIPESNSLLGVK
AGPLMKEKPKRNGARGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQ
QTRISASSATRELDELMASLSDFKTSSSAVALSSLGLLPSSASSTHHVLPSPAPSPPGPP
AFLPSVIKPSPQGHEHTTQVLCNEHSDDGQGLLPPVAPSGRDLAGLGVMRDTPNSRSPSA
EGSLGPFGAESQAQVWRDELNHTSELSRTPPGHSLPRAAYTGPQEPGDPQGLWANPVHPE
EALAATWKQPWALEALRPETPRGATPSFQEVTEPTIVPIDRQVIFPDTWSLTKEHGQLKD
RARSESARLESSCPAPIDVEQLGGETPMRGSLVRPTQGPETPRRPEGTTEAAAEAKRGQP
ELPHAMVTDTPSTTERISTSGQAGASLHGCWAWSSLGLSVGRSWLTACHLLLCACLLGQQ
ILRYRGL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagctcctctctgggcagcaacctttcagaacttgaccgcctgctgctggaactgaat
gccgtgcagcacaaccccccgggcttccccgcagatgagaccaactcaagcccccccttg
cctggggctctgagccctcactatggcatcccggagagtaacagcctgctgggagtcaaa
gctgggcccctgatgaaagagaagcccaagcggaacggggcccggggcctggaggacgtt
cggcccagtgtggagagtctcctggatgagctggagagctctgtgcccagccccgtccct
gccatcactgtgaaccagggcgagatgagcagccctcagcgagtcacctccagccagcag
cagacacggatctcggcctcctccgccaccagggagctagatgagctgatggcctccctg
tcggattttaagaccagctcctctgctgtggccttgagctccctggggctgctgcccagt
tcagcttcatccacacaccacgtccttccttctcctgctccctctcctcccgggccccct
gcattcttgccatccgttattaaaccctcccctcaaggccacgagcacaccacacaggtc
ctctgcaatgagcatagtgatgatggacagggccttttacctcctgtggcccccagcggg
cgtgatttggctggcctcggggtgatgcgcgacacccccaactcaaggtctccctctgca
gagggttctctggggccatttggtgcagagagccaggctcaagtttggagggacgaacta
aaccacacgagtgagctctccaggactcccccaggccacagtttaccccgagctgcgtat
acaggtccccaggagcccggagacccccaagggctgtgggccaaccctgtgcacccagag
gaggccttggctgccacgtggaagcagccgtgggccttggaggcgctcaggcccgagact
ccccgcggagctacgcccagcttccaggaagtaactgagccaactatcgtgcccatagac
cgtcaggtcatcttcccagatacctggagtctcacgaaggaacacggacagctgaaggac
agggcaaggtcagagtcagccaggctggagagcagctgccctgctcccattgatgtggag
cagttaggtggagagacgcccatgaggggaagcctggtcaggccaactcagggacctgag
acacccaggaggccagagggcaccactgaagctgctgctgaggccaagaggggacagccg
gagcttccacatgccatggtcacggacacgcccagcaccaccgagaggatttccacctct
ggccaggcaggcgcgagcttgcacggctgctgggcctggtcctcactgggcctgagtgtg
ggccgctcctggctaactgcatgccacctcctactctgcgcatgtctgcttgggcagcaa
atcctaagatatcgtggcctgtga

DBGET integrated database retrieval system