KEGG   Miniopterus natalensis: 107528546
Entry
107528546         CDS       T05883                                 

Gene name
SLC17A6
Definition
(RefSeq) vesicular glutamate transporter 2
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107528546 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    107528546 (SLC17A6)
   04721 Synaptic vesicle cycle
    107528546 (SLC17A6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107528546 (SLC17A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107528546 (SLC17A6)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   107528546 (SLC17A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    107528546 (SLC17A6)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 107528546
NCBI-ProteinID: XP_016057132
LinkDB
Position
Unknown
AA seq 554 aa
MESVKQRVLTPGKEGLKNFAGKSLGQIYRVLERKQDTGETIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEIYEFLLF
FRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLER
SRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKH
PTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLI
SQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSRQILSTTTVRKIMNCG
GFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNG
VGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEET
SEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQEEGQD
SRTYEDRDEYSQHS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggagtccgtaaaacaaagggttttgaccccaggaaaagaggggctaaagaattttgct
ggaaaatccctcggccagatctacagggtgctggaaaggaagcaggacaccggggagacc
atcgagctgacggaagatgggaagcccctggaggtgcccgagaagaaggcgccgctgtgc
gactgcacgtgcttcgggctcccgcgccgctacatcatcgccatcatgagcggcctgggc
ttctgcatctccttcggcatccgctgcaacctgggcgtggccatcgtggacatggtcaac
aacagcaccatccaccgcgggggcaaggtcatcaaggagatctatgaattccttttgttt
ttcagggtttttggagctgccatacttcttacctctaccctgaatatgctaatcccatca
gcagccagagtgcactatgggtgtgtcatctttgttaggatactgcaggggctcgttgag
ggtgtcacctacccagcctgtcatggcatatggagcaaatgggccccccctctcgagagg
agtagattggccaccacctccttttgtgggtcctacgctggggctgtgatcgcgatgccg
ctggcgggcatcctggtgcagtacacgggctggtcgtccgtgttctacgtctacggaagc
tttgggatggtctggtacatgttttggcttttggtgtcttatgagagtcctgcaaagcat
cctaccattacagatgaagaacgtaggtacatagaagaaagcattggagagagtgcaaat
cttttaggtgcaatggaaaaattcaagactccatggaggaaattttttacatctatgcca
gtctatgcaatcattgttgcaaacttctgcagaagctggactttttatttattgcttatt
agtcagccagcatattttgaggaagtctttggatttgaaatcagcaaggttggcatgctg
tctgcggtgccgcacttagtaatgacaattattgtgcctattggagggcagatcgcagac
tttctaagaagcaggcaaatcctctcaaccactacagtaagaaagatcatgaactgtggt
ggttttggcatggaagcgactctgcttctggtcgtcggctactctcacactaggggggta
gccatctccttcttggtacttgccgtggggtttagcggattcgctatatcaggtttcaat
gttaaccacctggatattgctccaagatacgccagtatcttaatgggcatttcgaatgga
gttggcaccttgtcgggaatggtctgccctatcatcgtgggtgcgatgacaaaaaataag
tcacgcgaggagtggcagtacgtcttcctgatcgctgccctcgtccactacggcggagtt
atattttacgcaatctttgcctcaggagagaagcaaccctgggcagaccctgaggaaaca
agtgaagagaaatgtggatttatccacgaagatgaacttgatgaagaaacgggggacatt
actcaaaattatataaattatggtaccaccaagtcttatggcgccacgacgcaggccaac
ggcgggtggcccagcgggtgggaaaagaaagaagaatttgtacaagaggaagggcaagac
tcgcgcacctatgaggaccgggatgagtactcacaacacagctaa

KEGG   Miniopterus natalensis: 107531888
Entry
107531888         CDS       T05883                                 

Gene name
SLC17A7
Definition
(RefSeq) vesicular glutamate transporter 1
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107531888 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    107531888 (SLC17A7)
   04721 Synaptic vesicle cycle
    107531888 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107531888 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107531888 (SLC17A7)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   107531888 (SLC17A7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    107531888 (SLC17A7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 107531888
NCBI-ProteinID: XP_016061547
LinkDB
Position
Unknown
AA seq 560 aa
MEFRKEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHLVVQKAQFNWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEEAIGESAKLMNPLTKFNTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEETSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPS
YGAIHSTVQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccgcaaggaggagtttcggaagctagcgggtcgcgccctcgggaggctgcac
cgccttctggagaagcggcaggagggcgcggagacgctggagctgagtgctgacgggcgc
ccagtcacgacgcagactcgggacccgcccgtggtggactgcacctgcttcggcctcccc
cgccgatacattatcgccatcatgagcggcctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaacaacagtacgacccaccgcgggggc
cacctggtggtgcagaaagctcagttcaactgggatccagagactgttggcctcatacac
ggctcctttttctggggctacattgtcacccagattcccgggggattcatctgccaaaag
ttcgcagccaacagggttttcggctttgctatcgttgctacatccactctaaacatgttg
atcccctcggctgcccgagtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ctggtagagggggtcacgtaccccgcctgccacgggatctggagcaaatgggcccctccc
ttagagcggagtcgcctggcgaccacagccttttgtggttcctatgcgggggcggtggtc
gcgatgcctctcgccggggtcctggtgcagtactcgggatggagctccgtgttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcttacgagtccccg
gcgctgcaccccagcatttcagaagaggagcgcaagtacatcgaggaagccatcggcgag
agcgccaagctcatgaaccccctcacgaagttcaacacgccctggcgccgcttcttcacg
tccatgcccgtctacgccatcatagtggccaacttctgccgcagctggaccttctatctg
ctccttatctctcagcccgcctatttcgaagaagtgttcggcttcgagatcagcaaggtg
ggcctggtgtcagcgttgccccacctggtcatgaccatcatcgtgcccatcggtggccag
atcgcggacttcctgaggagccgccgcatcatgtccaccaccaacgtgcgcaaattgatg
aactgtgggggcttcggcatggaagccacgctgctgctggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctcgctgtgggcttcagcggcttcgccatctct
gggttcaatgtgaaccacctggacatcgccccgcgctatgccagcatcctcatgggcatc
tccaatggcgtgggcacattgtcgggcatggtgtgtcccatcatcgtgggtgccatgacc
aagcacaagactcgggaggagtggcagtacgtgtttctaatcgcctccctggtgcactat
gggggtgtcatcttctacggcgtcttcgcttctggagagaagcagccatgggcggagcct
gaggagacgagcgaagagaagtgtggctttgttggccatgaccagctggcgggcagtgat
gaaagcgaaatggaggatgaggctgagccccctggggcaccccctgcgccccctccctcc
tatggggccatacacagcacagttcagcccccaagacccccaccccctgtccgggactac
tga

KEGG   Miniopterus natalensis: 107545115
Entry
107545115         CDS       T05883                                 

Gene name
SLC17A8
Definition
(RefSeq) vesicular glutamate transporter 3 isoform X1
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107545115 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    107545115 (SLC17A8)
   04721 Synaptic vesicle cycle
    107545115 (SLC17A8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107545115 (SLC17A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107545115 (SLC17A8)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   107545115 (SLC17A8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    107545115 (SLC17A8)
SSDB
Motif
Pfam: MFS_1 BT1 Oxidored_q5_N
Other DBs
NCBI-GeneID: 107545115
NCBI-ProteinID: XP_016078645
LinkDB
Position
Unknown
AA seq 588 aa
MPFKALDTFREKILKPGKEGVKTAVGGSLGILQRKIDGTTEEENNIELNEEGRPVQAPRP
SPPLCDCHCCGIPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGFIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGV
LVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISHEERTYIETSIGEGANVVSL
SKFNTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSALPH
MVMTIIVPVGGQLADYLRSRHILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKVVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMICPLIVGAMTKHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSDEKCGIIDQDELAEETELNHETLA
SPRKKMSYGATTQNCEIQREWRGQGGATLDEEELTSYQDEEGSFSDTS
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgccttttaaagccctggataccttcagagaaaaaattctgaaacccggaaaggaagga
gtgaagactgccgtgggaggttcgctggggattttacaaagaaaaatcgatgggaccacc
gaggaagaaaataacatcgagctgaatgaggagggaaggccggtgcaggcgcccaggccg
agccccccactctgtgactgccactgctgcggcatccccaagcgttacatcatcgccatc
atgagcgggctgggattctgcatttcctttgggattcgctgcaaccttggagttgccatc
gtggaaatggtcaacaacagcactgtctacgttgatgggaaaccggaaattcagacagca
cagtttaactgggatccagagacagtgggctttatccatggatcttttttctggggttat
atcgtgacacaaattccaggtggtttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcctaacgtcgaccttgaacatgttcattccttctgcagcccgagtg
cattacggctgcgtcatgtgtgtcaggattttgcaaggtctagtggagggtgtgacctac
ccagcctgccacggaatgtggagtaagtgggcaccgcctttggagagaagcagactggcc
acgacctccttttgcggttcctacgcgggggcggtgatcgccatgcccctggccggggtg
ctggtgcagtacattggctgggcctccgtcttttatatttatggtatgtttggcattatt
tggtacatgttttggctgttgcaggcctatgagtgcccggcagctcatccaacaatatcc
catgaggagaggacctatatagagacaagtatcggagaaggagccaatgtggtcagtctc
agtaaatttaatacaccatggaaaagatttttcacgtcactgccggtgtatgcaatcatt
gtggcaaatttttgcagaagctggaccttttatttgctgttaataagtcagccggcttat
tttgaagaggtctttggatttgcaataagtaaggtgggcctcctgtcggcgctcccgcac
atggttatgaccatcatcgtgcctgtcggaggacaactggccgattatttaagaagcaga
cacattttgaccacaactgctgtcaggaaaatcatgaactgtggaggctttggcatggag
gcaaccttactcctggtggttggcttttcccacaccaaagtggtggcgatctccttcctg
gtgctggctgtgggatttagtggctttgctatttcaggttttaatgtcaaccacctggac
attgcccctcgttatgccagcattctcatgggcatctccaacggcgtggggaccctctcc
ggaatgatctgtcccctcatcgtcggtgcgatgaccaagcacaagacccgagaggagtgg
cagaacgtgttcctcatcgcggccctggtgcactacagcggcgtcatcttctacggggtc
tttgcctctggggagaagcaggagtgggccgaccccgagaacctctccgatgagaagtgt
gggatcattgaccaagatgagctggccgaggagacagagctcaaccacgagaccctcgca
agtcccagaaagaagatgtcctatggagccaccacccagaattgtgaaatccagagggaa
tggagaggacaggggggagcgaccctcgatgaggaagagctcacatcttaccaggatgaa
gagggaagcttctcagatacgtcctaa

DBGET integrated database retrieval system