KEGG   Miniopterus natalensis: 107528557
Entry
107528557         CDS       T05883                                 

Gene name
ANO5
Definition
(RefSeq) anoctamin-5 isoform X1
  KO
K19480  anoctamin-5
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528557 (ANO5)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107528557 (ANO5)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 107528557
NCBI-ProteinID: XP_016057156
LinkDB
Position
Unknown
AA seq 892 aa
MFFFLSFLLNPERANRDADFDFEMLGSRESSLLIIDKPRFKKDEQSKDSTFFRDGVRQID
FVLSYVDDVKKETDLKVERRKEFEQNLRKTGLELEIEDKMNSEDGRTYFVKIHAPWEVLV
TYAEVLGIKMPIKESDIPRPETFSFNCMLGPLKLARNVKYPHPEYFTAQFTRHRQELFLI
DDQSTFFPSSSRNRIVYYILSRCPFGIEDGKKKIGIERLLTSYTYSAAFPLHDGQYWKPS
EPPNPVNERYTLFQNWARFSYFYKEQPLDLIRNYFGEKIGMYFVFLGFYTEMLFFAAIVG
LACFIYGLFSMHNSTSSTEICDPEIGGQIIMCPLCDVVCDYWRLNSTCLSSKVSYLFDNE
STVFFAIFMGIWVTLFLEFWKQRQARLEYEWDLVDFEEEQQQLQLRPEFEAMCKHRKMNP
VTKEMEPHLPLHKRLPWYFLSGATVALWMSLVLACMVAVIVYRLSVFATFASFMESEASL
KHVKSFLTPQITTSLSGSCLNFIVILILNFFYEKISAWITKMEIPRTYQEYESSLTLKMF
LFQFVNFYSSCFYVAFFKGKFVGYPGKYTYMFHVWRSEECDPGGCLIELTTQLTIIMTGK
QVFGNIQEAIYPWVLNWWRRRKSRTNSEKLYSRWEQDHDLETFGSLGLFYEYLETVIQFG
FVTLFVASFPLAPLLALLNNIIEIRVDAWKLTTQYRRPVAAKAHSIGVWQDILYGMAVLS
VATNAFIVAFTSDMIPRLVYYYAYSTNASEPLRGYVNNSLSIFLIADLPNHTAPSEKRDY
TTCRYRDYRYPPDHDQKYFHNMQFWHVLAAKMTFIIVMEHIVFLVKFLVAWMIPDVPKDV
LDRIKREKLMIVKILHDFELKKLKENLIFDSQEFAKEFLIQENKVQLAKSTV
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgtttttttttctttctttcttacttaatccagaaagagcgaatagggatgcagacttt
gattttgagatgctgggcagcagagagagcagcttgctcatcattgacaaaccaaggttt
aaaaaagatgagcaaagcaaagactctaccttcttccgagatggggtgaggcaaatcgat
tttgtgctttcctatgttgatgatgtaaagaaagaaacggacttaaaggtggaaagaaga
aaagagtttgaacaaaatctcagaaaaacaggcctggagttggaaattgaagacaaaatg
aactctgaagatggaagaacttactttgtcaagatccatgccccttgggaggtgttagtg
acttacgctgaagtgctgggaatcaaaatgcctattaaagagagtgatattccccgacct
gagaccttctcctttaactgtatgcttggtcctctgaagctcgcaaggaacgtgaagtat
cctcaccctgagtatttcactgcccagttcaccagacatcgccaggaactcttcctcatc
gatgaccagtcaaccttcttcccatcctcgtcaagaaacagaattgtttattatattctg
tcgcgatgtcctttcggcatagaagacgggaagaaaaagattgggattgagcgactgcta
acttcctacacttactcggctgcctttccactccatgatggtcaatattggaagccatcg
gaacctcctaatcctgtcaatgaaaggtacacacttttccagaattgggctcggttttcc
tatttttacaaggagcagcctttagacttgattaggaattattttggagaaaaaattggc
atgtattttgtctttctcggattctacacagaaatgctgttctttgcagctatagttggc
ttagcttgttttatttatggcttattttcaatgcataatagcacaagcagcactgaaatc
tgtgaccctgagattggaggtcaaattatcatgtgcccactctgtgatgtagtgtgtgat
tattggagactaaattctacatgtttgtcttcaaaggtctcttatttatttgataatgag
tcaacagtgttttttgcaatattcatgggaatttgggtcacgttgtttttggagttttgg
aaacagcgtcaagccagactggaatatgagtgggacctggtggactttgaggaggaacag
cagcaacttcagctgagacctgaatttgaagctatgtgtaaacataggaaaatgaatcca
gtgactaaggagatggaacctcacttgcccctacataaacggcttccatggtacttctta
tcaggagccacagtggcactatggatgtctcttgtcctcgcgtgcatggtagctgtgatt
gtgtaccgcctgtcagtctttgctacatttgccagcttcatggaaagtgaagcatcctta
aaacatgtcaaaagcttccttacccctcagataaccacgtcactcagcgggtcatgcttg
aactttatagtcatcttgatcttgaatttcttttacgaaaagatatctgcctggattacg
aagatggaaattcctcgaacctaccaggagtacgaaagcagcctgaccttgaaaatgttc
ctgtttcagtttgtaaatttttattcatcgtgtttctacgtagctttctttaaagggaag
tttgtgggctaccccggaaagtacacctatatgtttcatgtgtggagaagtgaagagtgt
gatcctggaggctgtctcatagaactgacaacccagttgaccatcataatgacggggaaa
caggtcttcggaaacattcaagaagccatttatccctgggttctgaattggtggagacgc
cgaaaatctcggaccaactctgagaagttatacagtcgatgggagcaggatcatgacctt
gaaacttttggaagtcttgggctattctatgaatacttagaaacagttatccagtttgga
tttgttacattatttgtggcctcttttcctttggctcctctccttgccctcctgaataac
atcatagagatccgcgtggatgcctggaaacttacgactcagtacaggagacctgtagct
gctaaagctcatagcataggtgtttggcaagacatcctttacggaatggctgtcctttct
gtggctactaatgcttttattgttgcatttacatcagacatgattccccgtttagtgtac
tactatgcctactcaacaaatgccagtgagccgttgagaggatacgtcaataacagcctg
tcaatattcctgatagctgacttaccaaaccacactgcgccttcggaaaaacgagactac
accacttgcaggtacagagattacagatatcctcctgatcatgatcagaaatacttccat
aatatgcagttctggcatgtccttgctgccaaaatgaccttcatcatagttatggagcac
attgtatttttagttaaatttttggtggcttggatgatccctgatgttccaaaagatgtt
ctggacagaatcaagcgagaaaagctaatgatagtcaagattctccatgattttgagctt
aaaaaattaaaagagaacttgatatttgattctcaggaatttgccaaggaattccttatt
caggaaaacaaagtacagctggctaaatcaacagtctag

DBGET integrated database retrieval system