KEGG   Miniopterus natalensis: 107528628
Entry
107528628         CDS       T05883                                 

Gene name
CD8A
Definition
(RefSeq) T-cell surface glycoprotein CD8 alpha chain
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04660  T cell receptor signaling pathway
mna05135  Yersinia infection
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107528628 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107528628 (CD8A)
   04612 Antigen processing and presentation
    107528628 (CD8A)
   04660 T cell receptor signaling pathway
    107528628 (CD8A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107528628 (CD8A)
  09163 Immune disease
   05340 Primary immunodeficiency
    107528628 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107528628 (CD8A)
CD molecules [BR:mna04090]
 Proteins
  107528628 (CD8A)
SSDB
Motif
Pfam: V-set ig Ig_5 Ig_4 I-set
Other DBs
NCBI-GeneID: 107528628
NCBI-ProteinID: XP_016057248
LinkDB
Position
Unknown
AA seq 166 aa
MRLCGRGLGKAASVPDGLKTQVSGEGSQGKYTLTLHNFREENQGYYFCATLSNSMLYFSP
FVAVFLPDFNVTLASSWFRMSREEKVVTLGGSVKLSCELLQDMTPRGLHFPCVIYIWAPL
AGACAVLLLSLIITVICIHRNRRRVCKCPRPLVRPGVKPSPAERYV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaggctgtgtggccgaggcctggggaaggcggcaagcgtgcccgacgggctgaagacc
caggtctctggcgaggggtcgcagggaaagtacaccctcactctgcacaacttccgcgag
gagaaccaaggctactatttctgcgccaccctgagcaactcgatgctgtacttcagcccc
ttcgtggccgtcttcctgccagacttcaacgtgaccctcgcgtccagctggttccgaatg
tcgcgggaggagaaggtggtgaccctgggcgggtctgtgaagctgagctgcgagttgctg
caggacatgaccccgaggggcctgcacttcccctgtgtcatctacatctgggcgcctctg
gccggggcctgcgcggtgcttctcctgtctctgatcatcacagtcatctgcatccacagg
aaccgaagacgcgtttgcaaatgtcccaggcccctggtcaggcccggagttaagcccagc
cctgcagagagatacgtctaa

KEGG   Miniopterus natalensis: 107528645
Entry
107528645         CDS       T05883                                 

Gene name
CD8B
Definition
(RefSeq) T-cell surface glycoprotein CD8 beta chain isoform X1
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04660  T cell receptor signaling pathway
mna05135  Yersinia infection
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107528645 (CD8B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107528645 (CD8B)
   04612 Antigen processing and presentation
    107528645 (CD8B)
   04660 T cell receptor signaling pathway
    107528645 (CD8B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107528645 (CD8B)
  09163 Immune disease
   05340 Primary immunodeficiency
    107528645 (CD8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107528645 (CD8B)
CD molecules [BR:mna04090]
 Proteins
  107528645 (CD8B)
SSDB
Motif
Pfam: V-set Ig_3 Herpes_gE I-set ig Izumo-Ig
Other DBs
NCBI-GeneID: 107528645
NCBI-ProteinID: XP_016057259
LinkDB
Position
Unknown
AA seq 210 aa
MWLWLWLLLAAQREALQGISAFQPTSEDRTVQTNTNVLLSCEARTITANMPIYWLRWRRD
LSMDSHYEFLACWDPTKLTTVYGKDMEQKLNVSQRATQSAVTLRRVKPADSGVYLCMTVG
TPELSFWKRIQLSVVDVLPTTAQPTTKSTPKKIRCRSPSLVTPKGPPCGPLILGLLLTGT
LILLVSLGVAIHICCLRRRARLRFMKQFYK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtggctttggctctggctgctcctcgccgcgcagcgggaagctctccagggcatctct
gcattccagccgacctccgaggaccgaacggttcagaccaacacaaacgtgctgctatcc
tgtgaagccagaaccatcaccgctaacatgcccatctactggctgagatggcgccgggac
ctaagtatggacagtcactatgagttcctggcctgctgggatcctacaaaacttacgact
gtgtatggcaaggatatggagcagaagctaaatgtgagtcagcgggcaacccagtccgct
gtcactctcagaagagtgaagcctgcggacagtggtgtctacctctgcatgaccgtcggg
acccctgagctgtccttctggaagagaattcagctgagtgtggttgatgtcttgcccaca
actgcccagcccaccacgaagtccacccctaagaagataagatgccggtccccaagcctg
gtgactccgaagggcccgccttgtggcccccttatccttggcctgctgctgaccggcacc
ctgattctgctggtgtccttgggtgtagccattcacatatgctgcctgcggcggagagcc
cggcttcgcttcatgaagcagttttataaatga

DBGET integrated database retrieval system