KEGG   Miniopterus natalensis: 107528648
Entry
107528648         CDS       T05883                                 

Gene name
PAX8
Definition
(RefSeq) paired box protein Pax-8 isoform X1
  KO
K09293  paired box protein 8
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107528648 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528648 (PAX8)
   05202 Transcriptional misregulation in cancer
    107528648 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    107528648 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107528648 (PAX8)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    107528648 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 HTH_38
Other DBs
NCBI-GeneID: 107528648
NCBI-ProteinID: XP_016057264
LinkDB
Position
Unknown
AA seq 457 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDSKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECP
FERQHYPEAYASPSHTKGEQGLYPLPLLNSALDDGKATLTPSNTPLGRNLSTHQTYPVVT
DPHSPFAIKQESPEVSSSSSTPSSLSSSAFLDLQQVGSGVPAGASVPPFNAFPHAASVYG
QLAGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSDYSGNAYGHTPYSSY
SEAWRFPNSSLLSSPYYYSSTSRPSGPPTTATAFDHL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatcagatccggccacggagggctgaaccagctgggaggggccttt
gtgaatggcagacccctgcccgaagtggtgcgtcagcgcatagtggacctggcccaccag
ggtgtgaggccctgcgacatctcccgccagcttcgtgtcagccatggttgtgtcagcaag
attcttggcaggtactacgagactggcagcatccggcctggggtgataggtggctccaag
cccaaggtggctacccccaaggtggtggagaagatcggggactacaagcgacagaacccc
accatgtttgcctgggagatccgagatcggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcagccattc
aatcttcccatggacagctgcgtggccaccaagtccctgagcccaggacacacgctgatc
cccagctcagccgtgacacccccggagtcaccccagtccgactctctgggctccacctac
tccatcaatgggctgctggggatcgcccagcctgggagcgacagcaagaggaagatggat
gacagtgaccaggacagctgccggctgagcatcgactcccagagcagcagcagcgggccc
cgcaagcacctccgcacagacgccttcagccagcaccacctcgagcccctcgagtgcccc
ttcgagcggcagcactaccccgaggcctatgcctctcccagtcacaccaaaggcgagcag
ggcctctacccactgcccctgctcaacagcgccctggatgatgggaaggccaccctgacc
ccttctaacacacctttggggcgcaacctctcgactcaccagacctaccccgtggtgaca
gatcctcactcacccttcgccataaagcaggaaagccccgaggtgtccagttctagctcc
accccttcctctttatctagctccgcctttttggacctgcagcaagtcggctctggggtc
ccagcgggagcctcggtcccgcccttcaatgcctttccccacgctgcctccgtgtatggg
cagctcgcgggccaggccctcctctcagggcgagagatggtggggccaacgctgcccgga
tacccaccccacatccccaccagcggacagggcagctatgcctcttctgccatcgcaggc
atggtggcaggaagcgactactctggcaatgcctacggccacaccccctactcctcctac
agcgaggcctggcgcttccccaactccagcttgctgagttctccatattattacagttcc
acatcaaggccgagcgggccacccaccactgccacggcctttgaccacctgtag

DBGET integrated database retrieval system