KEGG   Miniopterus natalensis: 107528842
Entry
107528842         CDS       T05883                                 

Gene name
RAMP2
Definition
(RefSeq) receptor activity-modifying protein 2
  KO
K08448  receptor activity modifying protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107528842 (RAMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107528842 (RAMP2)
G protein-coupled receptors [BR:mna04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    107528842 (RAMP2)
SSDB
Motif
Pfam: RAMP
Other DBs
NCBI-GeneID: 107528842
NCBI-ProteinID: XP_016057497
LinkDB
Position
Unknown
AA seq 197 aa
MCLEKKEHGTISYGNLEEGEVSSLCSAPKDPYSDPKLPGCSQGSMKTSNHLTAILKPQES
VAQLLTTEGSLKSEGKTEEEYYQNILHCWNNYKGHMDSIKDDWCNWAVISSPYSKLQNCL
EDNAEQFGLGFPNPLAEEVIFETHLIHFANCSLQPTFSDPPEDVLLAMIIAPICLIPFLV
TLVVWKSKDSEAQTKAA
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtgcttagaaaagaaagaacatgggaccatctcctatggtaacttggaagagggtgag
gtctccagtctctgttcagccccaaaggacccttatagcgaccccaagttaccaggatgc
tcccaggggtcaatgaaaacatccaaccatctaactgctatcctgaagccccaggagtcc
gtggctcagcttctcaccaccgaaggcagcttgaagtcagaagggaaaacggaggaggag
tactatcagaacattttacattgctggaacaactataagggtcatatggactctatcaaa
gacgactggtgcaactgggcggtgattagcagtccttatagcaaactccagaattgcttg
gaagataatgcagaacagtttggcctgggctttcccaatcccttggcggaagaagtcatc
tttgagactcacctgatccactttgccaactgctccctgcagcccaccttctcagacccc
ccagaggatgtgctcctggccatgatcatagcccccatctgcctcatcccgttcctggtc
acccttgtggtgtggaagagtaaagacagcgaagcccagactaaggcggcatga

KEGG   Miniopterus natalensis: 107529999
Entry
107529999         CDS       T05883                                 

Gene name
RAMP1
Definition
(RefSeq) receptor activity-modifying protein 1
  KO
K08447  receptor activity modifying protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107529999 (RAMP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107529999 (RAMP1)
G protein-coupled receptors [BR:mna04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    107529999 (RAMP1)
SSDB
Motif
Pfam: RAMP
Other DBs
NCBI-GeneID: 107529999
NCBI-ProteinID: XP_016059078
LinkDB
Position
Unknown
AA seq 189 aa
MHPTRGKWRSPPGKGHAVLPGTRQTAGQPPRDGSPRGPCAPDGKARPPGGDGPRAVLAVH
HLFAATACQDVDHDAILQEFCLAPFKVDMEAIGKPLWCDWGKTVESYGELADCTMHVMKK
LDCFWPNAAVNKFFVAVHQRYFRSCPASGRALQDPPSSILCPFILVPVLVTLLMTGLVAW
RSKRTEGIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcatcccaccaggggaaagtggcggtcaccaccggggaagggacatgcggtcctcccc
gggacccgtcagaccgcagggcagccccccagggacgggagccctcggggtccgtgtgcg
ccggatggaaaggcccggccgccagggggtgacggcccgcgtgctgtgcttgcagtgcat
cacctcttcgcggccaccgcctgccaggatgtcgaccacgacgccatcttgcaggagttc
tgcctcgccccgttcaaggtggacatggaagccatcgggaagccgctctggtgcgactgg
ggcaagaccgtcgagagctatggagagcttgcagactgcaccatgcacgtgatgaaaaag
ctggactgcttctggccaaacgcagcggtgaacaagttctttgtcgctgtccaccagcgc
tacttcagaagctgccccgcctcaggccgggccctgcaggacccgcccagcagcatcctc
tgccccttcattctggtgcccgtcctggtgaccctgctcatgacagggctggtggcctgg
agaagcaagcgcactgagggcatcatgtag

KEGG   Miniopterus natalensis: 107537041
Entry
107537041         CDS       T05883                                 

Gene name
CALCRL
Definition
(RefSeq) calcitonin gene-related peptide type 1 receptor isoform X1
  KO
K04577  calcitonin receptor-like
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537041 (CALCRL)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107537041 (CALCRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107537041 (CALCRL)
G protein-coupled receptors [BR:mna04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    107537041 (CALCRL)
SSDB
Motif
Pfam: 7tm_2 HRM DUF4034
Other DBs
NCBI-GeneID: 107537041
NCBI-ProteinID: XP_016068487
LinkDB
Position
Unknown
AA seq 465 aa
MMEKKCMLYFLFLLIFFMIPVIAESEESQDKQNALGVTRNKIMTAQYECYQKIMQESIQQ
TEGVHCNRTWDGWLCWNDVAAGTESIQHCPDYFQDFDPSEKVTKICDQDGNWFRHPESNR
TWTNYTQCNINTHERVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKN
LFFSFICNSIITIIHLTAVANNQALVATNPIGCKVSQFIHLYLMGCNYFWMLCEGVYLHT
LIVVAVFAEKQHLMWYYLLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPIC
AALLVNLFFLLNIVRVLITKLKVTHQAESYLYMKAVRATLILVPLLGIEFVLLPWRPEGR
VAEEVYDYIMHILMHYQGLLVSTIFCFFNGEVQAILRRNWKQYRTQFGNGFSHSDALRSA
SYTVSSVSDGTGYSNDYPSEHLNGKSTHDIENVVLKPEKFSDYIL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatggagaaaaagtgtatgctgtattttctgtttctcctgattttttttatgattcct
gtcatagcagaatcagaagagagccaagataaacaaaatgcgttgggtgttactagaaat
aaaattatgacggctcaatatgaatgttaccagaaaattatgcaagaatccattcaacaa
acagaaggcgttcactgcaatagaacctgggatggatggctgtgctggaatgatgtcgca
gcgggaacggaatcaatacagcactgccctgattactttcaagactttgatccttcagaa
aaagttacaaagatctgtgaccaagatggaaattggtttagacatccagaaagcaataga
acatggacaaattatacccagtgtaatattaacacacacgagagagtgaagactgcactg
aatttgttctacctgactataattggacatggattatctattgcatcactgcttatctca
cttggcatattcttttatttcaagagcctaagttgccaaaggattactttgcacaaaaat
ctgttcttctccttcatttgtaattctatcataacaataattcatctcactgctgtggcc
aacaaccaggccttagtggccacaaaccctattggttgtaaagtgtcccagttcattcac
ctttacctgatgggctgtaactacttttggatgctttgtgagggtgtttacttacacacc
ctcatcgtggtggccgtgtttgcagagaagcaacacttaatgtggtattatttacttggc
tggggatttccactgattcctgcttgtatacatgccatagccagaagcttatattacaat
gacaactgctggatcagctccgatacccatctcctctacatcatccacggcccaatctgt
gctgctttactggtgaacctcttcttcctcttaaatattgtccgtgtcctcatcactaag
ctcaaagtgacccaccaggcggaatcctacctgtacatgaaggcggtgcgggccacgctg
atcctggtgccgctgctgggcatcgagttcgtgctgctcccctggcggcccgagggccgg
gtggcggaggaggtgtacgactacatcatgcacatcctgatgcactaccagggtcttttg
gtctctacaattttctgcttctttaacggagaggttcaagcaattctaagaagaaactgg
aagcaatatagaactcagtttggaaacggcttttcccactcagatgctcttcgtagtgca
tcttacacagtgtcctccgtcagtgatggtacaggttacagtaatgactatccaagtgaa
cacttaaatggaaaaagcacccatgatattgaaaatgttgttttaaaaccagaaaagttt
agtgattatattttataa

DBGET integrated database retrieval system