KEGG   Miniopterus natalensis: 107528909
Entry
107528909         CDS       T05883                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein isoform X1
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03440  Homologous recombination
mna03460  Fanconi anemia pathway
mna04120  Ubiquitin mediated proteolysis
mna04151  PI3K-Akt signaling pathway
mna05206  MicroRNAs in cancer
mna05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107528909 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    107528909 (BRCA1)
   03460 Fanconi anemia pathway
    107528909 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107528909 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107528909 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    107528909 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107528909 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107528909 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107528909 (BRCA1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107528909 (BRCA1)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107528909 (BRCA1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107528909 (BRCA1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107528909 (BRCA1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107528909 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    107528909 (BRCA1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107528909 (BRCA1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     107528909 (BRCA1)
    BRCA1-A complex
     107528909 (BRCA1)
    BRCA1-B complex
     107528909 (BRCA1)
    BRCA1-C complex
     107528909 (BRCA1)
    BRCA complex
     107528909 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     107528909 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse BRCT_2 zf-RING_6 zf-RING_10 zf-ANAPC11 Prok-RING_4 zf-rbx1
Other DBs
NCBI-GeneID: 107528909
NCBI-ProteinID: XP_016057614
LinkDB
Position
Unknown
AA seq 1873 aa
MNLCVDRVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSKKGNNSPEHMKE
EVSMIQSLGFRNRALRLRQSEPENPTLQETSLSVQLSNLGIVRSLKTKQQVQSKKKSVYI
ELGSDSSEDAVNKASYYRFPDRDQNKLQPSVGDHELLEITPPEARTEATLNPAKRAAYEF
SEDIINIEHHQSSNKDLTTMEKHATEKHIEKYQGISVSNLHVEPCGTDTHARSLLQHENS
SLLLTKDRMNVEKAEFCNKSKQLGLARSQQSRWAESKETCNDRQNPRTEKRVVLNADPLN
ERKEPPCSDHPRDSQDFPWITRNSSIQKVNEWFSRRDEILTSDGSHNGTSESNVEVAGAV
EVPNEGDGYFGSSEKITLMARDPHGALICESERVHSKPVESNIEDKIFGKTYRRKASLPN
LSHITENLIIGASAIEPQITQECPLTNKLKRKRRSTSGLHPEDFIKKVDLAVVEETPEKI
IEGTDQVEQSGHVVNITNNHPDNETKGDYVQKEKNANPTESVEKESAFTTKAKPISSSVS
SMELELNTHSSKAPRKNRLKRKSSTRHIYALELVVNRNLSPPGHTELQIDSCSSSEEMKE
KNSDQVPVRHSQKCQLMEGKESATGARKSNKSNEQINKKLANDAFPELNLTNIPGFFTNG
SSTSKLQESVNPDPQREELEGDVGTIQMPNGAKDSLLSGGRSLQTDGSMESTNVVLVPET
DYGTQDSVSLLEPDTAGEAEAAPNQCAGLCTAIKNPNELIYGSKDTKNNREGFKDLLRCE
VNHSQETSIEMEESELDTQYLQNTFKVSKRQSFALFSNPEKECAADYAHSRSLRKQSPEV
TLDCGQKEENQEEEESKIKHVQAVHTTAGFPVACEKDKKPGEYAKYSIKGTSRLCQLSQF
RGNETELTLADKHRISQNPYHVPSISSIRSFVKTVSKRNLSEEKFEEHSVSPPERAMGNE
DIQSTVSPISLNNRESAFKDGSSSSTNEVGSSINEVGSSDENIQAELDRNRGSKLNAMLR
LGLMQPEVYKPSLPISNCKHPEIKSQGENEEVVQAVSAYFSPCQISDNLEQPMGSNSVSQ
VCSETPDDLLNDDEIKEKSSFDESDVKERSAVFSKSVQKEEFRRSPSPLANTHLTQHHQR
RARKLESSEEDMSSEDEELPCFQHLLFGKVTNIPSPSTRHNAVATRLSKETEENLISLKS
SLNNCSNQVMSAKASQKHHLSEEARCSRSLFSSQYSASEDLTTNTNTQDPFLMFEPPSQQ
VKCQPENQEVLSDKELISDDERETGLEENSQEEQSADSNLDEAASEYENETNLSEDCSEL
SSQSDILTTQQRDTMQDNLIKIKQEMDQLKAVLEQQESQPYDKSPSLIADSCASEDLLNL
EQNTSEKVLTSEKSNEYPISLNPESLSADKFQEPLDSSSRYKNKEPGVERSSPSTSQLLD
DRWYVPSHSQSLQNRNRPPQKELIESVDVLEQQPTKSETQDLMEQSYLPRQDLEGTPYLE
SGVSLFSDDPESDPSEDRAPEPAHVCSMPTSTSALKLPQFQVGESAKSLAAAQTTTAGYN
VREESVSGMKPEVISSTKTVNRRISMVASGLTTKEFMHVHKFARKYHITLTDLITEETTH
VIMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKILDEHDFEVRGDVINGRNH
QGPKRARESQDRKIFKGLEICCYGPFTNMATDQLEWMVQLCGASVVKEPSSFTLGKGTHP
IVVMQPDAWTDDSSFHVIGQMCEVPVVTREWVLDSVALYQCQELDTYLVLQIPGAAADSC
QPCVEPVSTGPQE
NT seq 5622 nt   +upstreamnt  +downstreamnt
atgaatttatgtgtggatcgcgttgaagaagtacaaaatgtccttaatgctatgcagaaa
atcttagagtgcccaatctgcctggagttaatcaaagagcctgtttccacaaaatgtgac
cacatattttgcaaattttgcatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccaaaagaagcctacaagaaagtacaagatttagt
caacttgttgaagagctattgaaaattattcatgcttttgagcttgacacaggattgcag
tttgcaaacagttataacttttcaaaaaaaggaaataacagtcctgagcatatgaaggag
gaagtttctatgatccagagtttgggcttccgaaaccgtgccttaagacttcgacagagt
gaacctgaaaatcctaccttgcaggaaaccagtcttagtgtccaactctctaaccttgga
attgtgagatcactgaagacaaagcagcaggtacaatctaagaaaaagtctgtctacatt
gaattgggatctgattcttctgaagatgcagttaacaaggcaagttattacaggttccct
gaccgggaccagaacaaattgcaacccagtgtgggggatcatgaattgttagaaatcacc
cctccagaagccaggactgaagccactttgaatcctgcaaaaagggctgcttatgagttt
tctgaggacataataaatattgaacatcatcaatctagtaataaagatttgaccaccatg
gagaagcatgcaactgagaagcatatagaaaagtatcagggtatttctgtttcaaacttg
catgtggagccatgcggcacagatactcatgccagatcgttgttacagcatgagaacagc
agtttactactcactaaagacagaatgaatgtagaaaaggctgaattctgtaataaaagc
aagcagcttggcttagcaaggagccagcagagcagatgggctgaaagtaaagaaacatgt
aatgataggcagaatcccagaacagagaaaagggtagttctgaatgctgatcctctgaat
gagagaaaagaacctccatgctctgaccatcctagagattcccaagattttccttggata
acacggaatagtagcatacagaaagttaatgagtggttttccagacgtgatgaaatatta
acttctgatggctcacataatgggacatctgagtcaaatgttgaagtagctggtgcagta
gaagttccaaatgaaggagatggatattttggttcttcagagaaaataaccttaatggcc
cgtgatcctcatggtgctttaatctgtgaaagtgaaagagtccactccaaaccagtagaa
agtaatattgaagataaaatatttgggaaaacctatcggaggaaggcaagcctccctaac
ttgagccacataactgaaaatctaattattggagcatctgctatagagcctcagataaca
caagagtgtcccctcacaaataaactaaagcgtaaaaggaggagtacatcaggccttcat
cctgaggattttatcaagaaagtagatttagcagttgttgaagagactcctgaaaagata
attgagggaacagaccaagtagagcagagtggtcatgtggtgaatattactaataatcat
cctgacaatgaaacaaaaggtgattatgttcagaaagagaaaaatgctaacccaacagaa
tcagtggaaaaagaatctgctttcacaactaaagccaaacctataagcagcagcgtaagc
agtatggaactagaattaaatacccacagctcaaaagcacctaggaagaacaggctgaag
aggaagtcctctaccaggcatatctatgcacttgaactagtagtcaatagaaatctaagc
ccacctggtcatactgaactacaaattgatagttgttctagcagtgaagagatgaaggaa
aaaaattctgaccaagtaccagtcagacacagccaaaagtgccaactcatggaaggtaaa
gaatctgcaactggagccaggaagagtaacaagtcaaatgaacaaataaataaaaaactt
gctaatgatgcttttccagaactgaatttaacaaacatacctggttttttcactaatggt
tcgagtactagtaaacttcaagagtcagtcaatcctgaccctcaaagagaagaactagaa
ggggatgtgggaacaattcagatgcctaatggtgccaaagactcgttgctaagtggggga
agaagtttgcaaactgatggatctatggagagtaccaatgttgtattggtacctgaaact
gattatggcacacaggatagtgtctcattactggaacctgacactgcaggggaggcagaa
gcagctccaaatcaatgtgcgggtctgtgtacagcaattaaaaaccccaatgagcttatc
tatggttctaaagatacaaaaaataacagagagggctttaaggatctgttgagatgtgaa
gttaaccactctcaggagacaagcatagaaatggaagagagtgaacttgatacacaatat
ttacagaatacattcaaggtttcaaagcgtcagtcatttgctctgttttcaaatccggaa
aaggaatgtgcagcagactatgcccactccaggtccttaaggaaacaaagtccagaagtc
actcttgattgtggacaaaaagaagaaaatcaggaagaggaagaatctaaaatcaagcat
gtgcaggcagttcacacaactgcaggctttcctgtggcttgtgagaaagacaaaaagcca
ggagagtatgccaaatatagcataaaaggaacctctaggctttgtcagttatctcagttc
agaggcaatgaaactgaactcactcttgcagataaacacagaatttcacaaaacccatat
catgtaccatccatttcttccatcaggtcatttgttaaaactgtaagtaagagaaacctg
tcagaagaaaagtttgaggaacattcagtgtccccacctgaaagagcaatgggaaatgag
gacattcaaagtacagtgagcccaattagcctaaataacagagagagtgcttttaaagat
ggcagctcaagtagtactaatgaagtaggctctagtatcaatgaagtaggttccagtgat
gaaaatattcaagcagaactagatagaaatagaggatcaaaattaaatgctatgctcaga
ctaggtctcatgcagcctgaagtctataagccaagccttcctataagtaattgtaaacat
cctgaaataaaatcgcaaggagaaaatgaagaagtagttcaggctgttagtgcatatttc
tctccatgtcaaatttcagataacctagaacaacctatgggaagtaattctgtttctcag
gtttgttctgagacaccagatgacttgttaaatgatgatgaaataaaggagaagagcagc
tttgatgaaagtgatgttaaggaaagatctgctgtttttagcaaaagtgtccagaaagaa
gaattcagaaggagccctagccccttagccaatacacatttgactcaacatcaccaaagg
agggccagaaaattagagtcctcagaagaggacatgtctagtgaggatgaagagcttcct
tgtttccaacacttactatttggtaaagtaaccaatataccttctccatctaccagacat
aatgctgttgccacacgtctgtctaaggaaacagaggagaacctaatatcattaaagagt
agcttaaataactgcagtaaccaggtgatgtctgcaaaggcatcccagaaacatcacctt
agtgaggaagcgagatgttctaggagcttattttcctcacagtacagtgcatcagaagac
ttgaccactaatacaaacacccaggatcctttcttgatgtttgagcctccttcccagcaa
gtgaagtgtcagcctgaaaaccaggaagttctgagtgacaaggaattgatttcagatgat
gaaagggaaactggcctcgaagagaatagtcaagaagagcagagtgccgattcaaactta
gatgaagcagcatctgagtatgagaatgaaacaaacctctctgaagactgttcggagctg
tcctctcagagtgatattttaacgactcagcagagggataccatgcaagataacctgata
aagatcaagcaggaaatggaccaactgaaagctgtgttagagcagcaggagagccagcct
tatgacaagtccccttccctcatagctgattcttgtgcttctgaggatctactaaatctg
gaacaaaacacatcagaaaaagtattaacttcagagaaaagtaatgaatatcctataagc
ctgaatccagaaagcctttctgcagacaagtttcaagagcctctggatagttctagcaga
tacaaaaataaagagccaggagtggaaagatcttctccttctacatcccagttgttagat
gataggtggtatgtgccgagccactcacagagccttcagaacagaaaccgcccacctcaa
aaggagctcattgagagtgttgatgtattggagcaacaaccgaccaagtctgagacccaa
gatttaatggagcagtcttatttgccaagacaagatctagagggaaccccttacctagaa
tctggagtcagcctcttctctgacgacccagagtctgatccctctgaagacagagcccca
gagccagctcatgtttgcagcatgccaacttcaacctctgcattgaaattaccccaattt
caagtgggagaatctgccaagagtctagctgctgctcagactactactgctgggtataat
gtgagggaagaaagtgtgagcggaatgaagccagaagtgatatcttcaacaaaaacagtc
aacagaagaatatctatggtggcctcaggcttgaccacaaaagaatttatgcatgtgcac
aagtttgccagaaaataccacatcactttaactgatctaattactgaagagactactcat
gtcattatgaaaacagatgctgagtttgtatgtgaacggacactgaagtattttctggga
attgcaggaggaaaatgggtagttagctatttctgggtgacccagtctattaaagaaaga
aaaattctagatgagcatgattttgaagtcagaggagatgttatcaatggaaggaaccac
caaggtccaaagcgagcaagagaatcccaggacagaaagatcttcaagggcctagaaatc
tgttgctatgggccctttaccaatatggccacagatcaactagaatggatggtgcagctt
tgtggggcttctgtggtaaaggaaccttcatcattcaccctcggcaagggtactcaccct
attgtggtcatgcagccggatgcctggacagatgacagtagcttccatgtgattgggcag
atgtgtgaggtgccggtggtgacccgagagtgggtattggacagcgtagccctctaccag
tgccaggagctggacacctacctggtactccagatccccggagctgctgctgattcctgc
caaccatgtgtagagcctgtctccacaggaccccaagaataa

DBGET integrated database retrieval system