KEGG   Miniopterus natalensis: 107528922
Entry
107528922         CDS       T05883                                 

Gene name
PSME3
Definition
(RefSeq) proteasome activator complex subunit 3 isoform X1
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
mna  Miniopterus natalensis
Pathway
mna03050  Proteasome
mna04612  Antigen processing and presentation
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    107528922 (PSME3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107528922 (PSME3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107528922 (PSME3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107528922 (PSME3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107528922 (PSME3)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    107528922 (PSME3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107528922 (PSME3)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 107528922
NCBI-ProteinID: XP_016057643
LinkDB
Position
Unknown
AA seq 265 aa
MEKWVLKKIKYLQSGGLSASHYDYKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPI
LNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGML
KSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVE
SEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYV
TLHDMILKNIEKIKRPRSSNAETLY
NT seq 798 nt   +upstreamnt  +downstreamnt
atggagaaatgggtcctcaaaaaaataaagtacttgcagtctgggggcctctcagcttct
cattacgattacaaggttgattctttcagggagcggatcacaagtgaggcagaggacttg
gtggcaaattttttcccaaagaagttgttagaacttgatagttttttgaaggaaccaatc
ctaaatattcatgacctaactcagatccactcagacatgaatctccctgtccctgacccc
atccttctcaccaacagccacgatggactggatggtcccacttacaaaaagcgaaggttg
gatgagtgtgaagaggcctttcaaggaaccaaggtgtttgtgatgcccaatgggatgcta
aaaagcaaccagcagctggtggacattattgagaaagtgaaacctgagatccggctgctg
attgagaaatgcaacacggtcaaaatgtgggtacagctcctgattcctaggatagaagat
ggaaacaactttggggtctccattcaggaggagacagttgcagaactaaggactgttgag
agtgaagctgcatcttatctggaccagatttctagatattatattacaagagccaaattg
gtttctaaaatagctaaatatccccatgtggaggactatcgccgaactgtgacagagatt
gatgagaaagaatatatcagccttcgtctcatcatatcagaactaaggaatcaatatgtc
accctacatgacatgatcctgaaaaatattgagaagatcaaacggccccggagcagcaat
gcagagacactgtactga

KEGG   Miniopterus natalensis: 107531677
Entry
107531677         CDS       T05883                                 

Gene name
PSME1
Definition
(RefSeq) proteasome activator complex subunit 1 isoform X1
  KO
K06696  proteasome activator subunit 1 (PA28 alpha)
Organism
mna  Miniopterus natalensis
Pathway
mna03050  Proteasome
mna04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    107531677 (PSME1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107531677 (PSME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107531677 (PSME1)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    107531677 (PSME1)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 107531677
NCBI-ProteinID: XP_016061266
LinkDB
Position
Unknown
AA seq 251 aa
MATLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKDPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKEDEDKGPPCGPVNCNEKIVILLQRLKPEI
KDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTALHTKLEGFHTQISKYFSER
GDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYVRRRGWGRGGQRQLSQAT
HPLTLQAGGEG
NT seq 756 nt   +upstreamnt  +downstreamnt
atggccacgctcagggtccagcctgaagcccaagccaaggtagatgtgttccgtgaagac
ctatgtaccaagacggagaatctgcttgggagctatttccccaagaagatttctgagttg
gatgcatttttaaaggatccagctctcaatgaagccaacctgagcaatctgaaggccccg
ttagacatcccagtgcctgatccagtcaaggagaaagagaaggaggagcggaagaaacag
caggagaaggaagacaaagatgaaaagaaaaaagaagacgaagacaaaggtcctccctgt
ggcccagtgaactgcaatgagaagatcgtgatcctcctgcagcgcctaaagcctgagatc
aaagatgtcattgagcagcttaacctggtcaccacctggttgcagctgcagatacctcgg
attgaggatggaaacaattttggagtggctgtccaggaaaaggtgtttgagctgatgact
gcccttcacaccaaactggaaggcttccacactcaaatctccaagtatttctctgaacgg
ggtgatgccgtgaccaaagcagccaagcagccccatgtgggtgattatcggcagctggtg
catgagctggatgaggcagagtaccgggacatccggctgatggtcatggagatccgaaat
gcttatgtgaggaggagagggtggggcaggggtgggcagaggcagctttcccaggccacc
catcccctgaccctacaggctgggggtgaagggtga

KEGG   Miniopterus natalensis: 107531680
Entry
107531680         CDS       T05883                                 

Gene name
PSME2
Definition
(RefSeq) proteasome activator complex subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
mna  Miniopterus natalensis
Pathway
mna03050  Proteasome
mna04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    107531680 (PSME2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107531680 (PSME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mna03051]
    107531680 (PSME2)
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    107531680 (PSME2)
SSDB
Motif
Pfam: PA28_beta PA28_alpha DUF4105
Other DBs
NCBI-GeneID: 107531680
NCBI-ProteinID: XP_016061270
LinkDB
Position
Unknown
AA seq 239 aa
MAKPCGVRLSGEARKQVDGFRQNLFQEAEEFLYRFLPQKIIHLNQLLQEDSLNVADLTSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKLLALLALVKPEVWTLKEKCIL
VISWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
ETHVMDYRALVHERDEAAYRELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaaaccttgtggggtgcgcctgagcggggaagcccgcaaacaggtggatggcttc
aggcaaaatcttttccaggaggctgaggaattcctctacagattcttgccacagaaaatc
atacacctgaatcagctcttgcaagaggactccctcaacgtcgctgacctgacttctctc
cgagccccactggacatccctattccagaccctccacccaaagatgatgagatggaaaca
gataaacaggagaagaaagaagtccccaagtgtggctttctccccgggaatgagaagctc
ctggccctgcttgccctggttaagccagaagtctggactctcaaagaaaaatgtatcctg
gtgatctcatggatccagcatctgatccccaagattgaggatggaaatgactttggggtg
gcaatccaggagaaggtactggagagggtgaatgcggtcaagaccaaagtagaagccttc
cagacaaccatttccaagtacttctcagagcgcggggatgctgtggccaaggcctctaag
gagacccatgtaatggattaccgggctctggtgcacgagcgagatgaggcagcctatagg
gagctcagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctggagaaaattgtcaacccaaagggtgaagagaagccatctatgtactga

DBGET integrated database retrieval system