KEGG   Miniopterus natalensis: 107528936
Entry
107528936         CDS       T05883                                 

Gene name
HSD17B1
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 1 isoform X1
  KO
K00044  17beta-estradiol 17-dehydrogenase [EC:1.1.1.62]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107528936 (HSD17B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107528936 (HSD17B1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107528936 (HSD17B1)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10 Epimerase
Other DBs
NCBI-GeneID: 107528936
NCBI-ProteinID: XP_016057671
LinkDB
Position
Unknown
AA seq 347 aa
MDRTVVLITGCSSGIGLHLALRLASDPSQSFKVYATLRDLSTQDQLWEAARSQGCPPGSL
ETLQLDVQDADSVAAARARVTEGRVDVLVCNAGRGLHGPLEAHSADAVGSVLDVNLVGMV
QMLQAFLPDMKRRRSGRILVTGSMGGLMGLPFNAVYCASKFAVEGLCESLAVLLPPFGIH
VSLIECGPVRTAFPEKVQDGLDVVLEGADAQTRDLFSQYQRHFEQVFREGAQDPEEVTEV
DARQGSGSEAALESWVSHPAPASPLPLPRRSSSEPCAPRSQPCATSPPSASCPWCGCASP
TPAAAAMSLPCTVQCSVTSPLRVQMVPRRRPEGENWEALSSALPQLP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaccgcacagtggtgctcatcactggctgctcctcgggcatcggcctgcacctggcc
ctgcgcctggcatcagacccgtcccagagcttcaaagtgtatgccactttacgggacctg
agcacacaggaccaactgtgggaggcagccaggtcccaagggtgccctcctggctccctg
gagacgttgcagctggatgtgcaggacgcagattccgtagctgctgccagggcacgtgtg
acagagggccgcgtggatgtattggtgtgcaatgccggccggggcctgcacgggccgctg
gaggcgcactcagctgatgccgtgggctctgtgctggacgtgaacttggtcgggatggta
cagatgcttcaggctttcctgccagacatgaagcgccgccgctcaggacgtatattggtg
actgggagcatgggaggcttgatggggctgcccttcaacgccgtttactgtgccagcaag
ttcgcagtcgaaggtttatgtgagagcctggctgttctgctgcctcccttcgggatccac
gtgagcctcatcgagtgcggcccagtgcgcactgccttcccggaaaaggtccaggacggc
ctcgacgtggtgctggagggtgcagacgcccaaacccgagaccttttctcccagtaccag
cgccacttcgagcaggtcttccgtgagggggcacaggacccagaggaggtgacagaggta
gatgccaggcagggctctgggagcgaggcggcactcgagtcctgggtttcgcatccagcc
ccagccagcccgcttcctctcccccgcaggtcttcctcagagccctgcgctcctcgcagc
cagccctgcgctacttcacctccgagcgcatcctgcccctggtgcggctgcgcctcgccg
accccagcggctgcagctatgtcgctgccatgcaccgtgcagtgttcagtgacaagcccg
ctgcgggttcagatggtgcccagacggaggccggagggggagaactgggaggccctgagc
tcagcgcttccccagctgccctga

KEGG   Miniopterus natalensis: 107535110
Entry
107535110         CDS       T05883                                 

Gene name
HSD17B7
Definition
(RefSeq) 3-keto-steroid reductase isoform X1
  KO
K13373  17beta-estradiol 17-dehydrogenase / 3beta-hydroxysteroid 3-dehydrogenase [EC:1.1.1.62 1.1.1.270]
Organism
mna  Miniopterus natalensis
Pathway
mna00100  Steroid biosynthesis
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Module
mna_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107535110 (HSD17B7)
   00140 Steroid hormone biosynthesis
    107535110 (HSD17B7)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107535110 (HSD17B7)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107535110 (HSD17B7)
    1.1.1.270  3beta-hydroxysteroid 3-dehydrogenase
     107535110 (HSD17B7)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 107535110
NCBI-ProteinID: XP_016065935
LinkDB
Position
Unknown
AA seq 263 aa
MTGLLALHFACRFQRFDYVYLNAGIMPNPHLNLRALFSSLFSRKMIRVFSTAEGLLTQDD
RVTADGLQEVFATNVFGHFVLIRELEPLLCPSDSPSRLIWTSSRSARRSNFSLEDFQHSR
GREPYSSSKYALDLLSVALNRNFNQRGLFSSVVCPGTMLTNLTYGIVPSFVWTLMMPIIW
LLRFFTNSFTLKPYNGAEALVWLFHQKPESLNSLTKYLSATTGFGSNYVTTEKMDLDEDT
AEKFYRKLLALEKHLRVTILSAD
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccggcctccttgccttgcattttgcttgcaggtttcagaggtttgactatgtgtac
ctgaacgctggcatcatgcccaacccacacctaaacctcagagcgctcttctccagcctg
ttttcaagaaaaatgattcgtgtgttctccacagctgaaggactgctgacccaggacgat
agggtcactgccgacgggctccaggaggtctttgcaaccaatgtctttggccactttgtc
ctgattcgggagctggaacctctcctctgtcccagtgacagcccctctcggctcatctgg
acgtcctcccgcagtgccaggaggtccaacttcagcctggaggacttccagcacagcaga
ggccgggagccctacagctcctccaagtacgccctggaccttctgagtgtggccttgaac
cgaaacttcaaccagcggggcctgttctctagtgtggtgtgcccggggaccatgctgacc
aacctgacctacggaatcgtgccctcctttgtgtggaccctgatgatgccaatcatatgg
ctgcttcgcttctttacaaactcgttcaccttgaagccgtacaacggagccgaggccctg
gtgtggctcttccaccagaagcctgagtctcttaactctctgaccaagtatctgagcgcc
accacaggcttcgggagcaactatgtgacgaccgagaagatggacctcgacgaagacact
gctgaaaaattttaccgaaaactactggccctggaaaagcaccttagggtcaccatcctg
agtgcagattag

DBGET integrated database retrieval system