KEGG   Miniopterus natalensis: 107528936
Entry
107528936         CDS       T05883                                 

Gene name
HSD17B1
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 1 isoform X1
  KO
K00044  17beta-estradiol 17-dehydrogenase [EC:1.1.1.62]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107528936 (HSD17B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107528936 (HSD17B1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107528936 (HSD17B1)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10 Epimerase
Other DBs
NCBI-GeneID: 107528936
NCBI-ProteinID: XP_016057671
LinkDB
Position
Unknown
AA seq 347 aa
MDRTVVLITGCSSGIGLHLALRLASDPSQSFKVYATLRDLSTQDQLWEAARSQGCPPGSL
ETLQLDVQDADSVAAARARVTEGRVDVLVCNAGRGLHGPLEAHSADAVGSVLDVNLVGMV
QMLQAFLPDMKRRRSGRILVTGSMGGLMGLPFNAVYCASKFAVEGLCESLAVLLPPFGIH
VSLIECGPVRTAFPEKVQDGLDVVLEGADAQTRDLFSQYQRHFEQVFREGAQDPEEVTEV
DARQGSGSEAALESWVSHPAPASPLPLPRRSSSEPCAPRSQPCATSPPSASCPWCGCASP
TPAAAAMSLPCTVQCSVTSPLRVQMVPRRRPEGENWEALSSALPQLP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaccgcacagtggtgctcatcactggctgctcctcgggcatcggcctgcacctggcc
ctgcgcctggcatcagacccgtcccagagcttcaaagtgtatgccactttacgggacctg
agcacacaggaccaactgtgggaggcagccaggtcccaagggtgccctcctggctccctg
gagacgttgcagctggatgtgcaggacgcagattccgtagctgctgccagggcacgtgtg
acagagggccgcgtggatgtattggtgtgcaatgccggccggggcctgcacgggccgctg
gaggcgcactcagctgatgccgtgggctctgtgctggacgtgaacttggtcgggatggta
cagatgcttcaggctttcctgccagacatgaagcgccgccgctcaggacgtatattggtg
actgggagcatgggaggcttgatggggctgcccttcaacgccgtttactgtgccagcaag
ttcgcagtcgaaggtttatgtgagagcctggctgttctgctgcctcccttcgggatccac
gtgagcctcatcgagtgcggcccagtgcgcactgccttcccggaaaaggtccaggacggc
ctcgacgtggtgctggagggtgcagacgcccaaacccgagaccttttctcccagtaccag
cgccacttcgagcaggtcttccgtgagggggcacaggacccagaggaggtgacagaggta
gatgccaggcagggctctgggagcgaggcggcactcgagtcctgggtttcgcatccagcc
ccagccagcccgcttcctctcccccgcaggtcttcctcagagccctgcgctcctcgcagc
cagccctgcgctacttcacctccgagcgcatcctgcccctggtgcggctgcgcctcgccg
accccagcggctgcagctatgtcgctgccatgcaccgtgcagtgttcagtgacaagcccg
ctgcgggttcagatggtgcccagacggaggccggagggggagaactgggaggccctgagc
tcagcgcttccccagctgccctga

KEGG   Miniopterus natalensis: 107542430
Entry
107542430         CDS       T05883                                 

Definition
(RefSeq) prostaglandin F synthase 1-like
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna00590  Arachidonic acid metabolism
mna00790  Folate biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107542430
   00590 Arachidonic acid metabolism
    107542430
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107542430
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107542430
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     107542430
    1.1.1.188  prostaglandin-F synthase
     107542430
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     107542430
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     107542430
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 107542430
NCBI-ProteinID: XP_016075227
LinkDB
Position
Unknown
AA seq 324 aa
MDSKCSHSVKLNDGHFMPVLGFGTLASEDVPKSKAAEATKVAIDVGFRHIDAAYVYQNEE
EVGKALREKIADGTVKREDIFYTTKLWATFFRPELVRPALERSLKKLQLDYVDLFIIHVP
IAMKPGEELMPKDANGKIILETVDLRDTWEALEKCKDAGLTKSIGVSNFNHKLLEMILNK
PGLKYKPVCNQVECHPYLNQSKLLEFCKSKDIVLVAYSALGSQKDQKWVEKDSPVLLEEP
VLKAIAKKHNRNPGQVALRYQVQRGVVVLAKSFNEKRIKENFQVLDFELTPEDMKAIDGL
NRNFRFFKLPFAIDHPYYPFSEEY
NT seq 975 nt   +upstreamnt  +downstreamnt
atggactccaaatgcagtcattctgtgaaactaaatgatgggcacttcatgccagtgctt
ggatttggcactcttgcttctgaagatgttcctaagagcaaggctgctgaggccaccaaa
gtggcaatcgatgtaggtttccgtcacattgacgcagcatacgtctatcaaaacgaagag
gaagtcggcaaggcccttcgagagaagattgcagacggcactgtgaagagagaggacata
ttctacaccaccaagctttgggctacgttctttcgaccagaattggttcgaccagccctg
gaaagatcactgaagaaacttcaactggactatgtcgatctcttcatcattcatgtgcca
atagctatgaagcctggagaggagcttatgccaaaggatgccaatgggaaaattatttta
gagacagtggacttgcgtgacacatgggaggccctggagaagtgtaaggatgcaggttta
accaagtccattggggtgtccaatttcaatcacaaactgctggaaatgatcctgaacaaa
ccagggctcaagtacaagcctgtctgcaaccaggtggaatgtcacccatacctcaaccag
agcaaactcctggaattctgcaagtccaaggatattgttcttgttgcctatagtgcccta
gggtcccaaaaagaccaaaaatgggtggaaaaggatagccctgttctcttggaggaaccg
gttttgaaggccattgccaagaaacacaatagaaatccaggccaggtggccctgcgctac
caagtacagcgaggggtggtggttttggccaagagcttcaatgagaagagaataaaagag
aacttccaggttttggactttgaactgactccagaagacatgaaagcgattgatggcctc
aacagaaatttccgattctttaaattgccatttgctattgatcacccctactatccattt
tctgaagaatattga

KEGG   Miniopterus natalensis: 107542432
Entry
107542432         CDS       T05883                                 

Definition
(RefSeq) prostaglandin-E(2) 9-reductase-like
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna00590  Arachidonic acid metabolism
mna00790  Folate biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107542432
   00590 Arachidonic acid metabolism
    107542432
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107542432
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107542432
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     107542432
    1.1.1.188  prostaglandin-F synthase
     107542432
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     107542432
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     107542432
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 107542432
NCBI-ProteinID: XP_016075228
LinkDB
Position
Unknown
AA seq 324 aa
MRAIRPFSVKLNDGYFMPVLGLGTSAPHKVAKSPVEKAVEKAIDVGYRSIDSAYIYQNEE
EIWRAIRKKIASGTVKREDIFYASKLWCTFFRPELVQIYLEESLRKLQLSYVDLFLIHFP
VALKPGKDIFPKDTDGKTIFDTVDFCTTWEALEKCKDAGLAKSIGVSNFNCRQLNMILNK
PGLKYKPVCNQVECHLYLNQNKLLDFCKSKDIALVAFGILGSDPEKEWVSKNYPVILENP
VINAIAEKHQRTPAQVSLRYQLQRGVIALVKSFTEKRIEENFQVFDFQLTPEDMKTLDGL
NRNLRYFKDDVFADHPDYPFNDEY
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcgtgcaataagacccttctctgtgaagctgaatgatggatacttcatgcctgttctg
ggactcggcacctcagctcctcataaggttgctaagagtccggtggaaaaggctgttgag
aaagcaattgatgtaggctatcgcagtattgattcagcctatatataccaaaatgaagaa
gagatttggagagccatcaggaagaagattgccagtggcactgtgaagagagaggacata
ttctacgcttcaaagctgtggtgcacttttttccgtccagaattggtccaaatttatctg
gaagagtcactgaggaaacttcaactgagctatgtggatctttttctcattcatttccca
gtagctttgaagcctgggaaggacattttcccgaaggacacagatgggaaaactattttt
gacacagtggatttctgtaccacctgggaggccctggagaagtgtaaggacgcaggattg
gccaagtccattggtgtgtccaactttaactgcaggcagctgaacatgattctgaacaaa
ccagggctcaagtataagcctgtctgcaaccaggtagagtgtcacctgtacctcaaccag
aacaaactgctggacttctgcaagtccaaggacattgccctcgtcgcgtttggtatcctg
ggctctgacccagagaaggagtgggtgagcaagaactacccagttatcctggagaaccca
gtaatcaatgccattgctgagaagcaccagcgaaccccagctcaggtgtccctgcgctac
cagctgcagcggggggtgatagccctggtcaagagcttcaccgagaagagaatcgaagag
aacttccaggtgtttgatttccagttgacgccagaggatatgaaaaccctagatggcctc
aacagaaaccttcgctattttaaagatgatgtgtttgctgatcacccagattatccattt
aatgatgaatattaa

DBGET integrated database retrieval system