KEGG   Miniopterus natalensis: 107528938
Entry
107528938         CDS       T05883                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04217  Necroptosis
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
mna04917  Prolactin signaling pathway
mna04920  Adipocytokine signaling pathway
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna05145  Toxoplasmosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107528938 (STAT3)
   04066 HIF-1 signaling pathway
    107528938 (STAT3)
   04068 FoxO signaling pathway
    107528938 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107528938 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107528938 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107528938 (STAT3)
   04062 Chemokine signaling pathway
    107528938 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107528938 (STAT3)
   04917 Prolactin signaling pathway
    107528938 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    107528938 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107528938 (STAT3)
   05206 MicroRNAs in cancer
    107528938 (STAT3)
   05205 Proteoglycans in cancer
    107528938 (STAT3)
   05203 Viral carcinogenesis
    107528938 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107528938 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107528938 (STAT3)
   05221 Acute myeloid leukemia
    107528938 (STAT3)
   05223 Non-small cell lung cancer
    107528938 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107528938 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107528938 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107528938 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    107528938 (STAT3)
   05161 Hepatitis B
    107528938 (STAT3)
   05160 Hepatitis C
    107528938 (STAT3)
   05163 Human cytomegalovirus infection
    107528938 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107528938 (STAT3)
   05169 Epstein-Barr virus infection
    107528938 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107528938 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107528938 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107528938 (STAT3)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107528938 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 107528938
NCBI-ProteinID: XP_016057675
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagcttgacacacggtacctggagcagcttcatcag
ctgtacagtgacagctttccgatggagctgcggcagttcctggccccttggattgagagt
caagattgggcttacgcagccagcaaagaatcacatgccactttggtgtttcataatctc
ctgggtgagattgaccagcagtacagccgcttcctacaagaatcaaatgtcctctaccag
cacaacctgcgaaggatcaagcagttccttcagagcaggtatcttgagaagcccatggag
attgcccgaattgtggcccggtgcctttgggaagagtcgcgcctcctccagactgcagcc
accgcagcccagcaagggggccaggccaaccaccccacagctgctgtggtaacagagaag
cagcagatgctggagcagcacctgcaggatgttcgcaagcgagtacaggatctagaacag
aaaatgaaagtggtggagaacctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctagaacagatgctaactgcgctggaccagatgcggcgaagcatcgtgagtgag
ctggcagggcttttgtcagctatggagtatgtgcagaaaactctcacggacgaggagctg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgctta
gatcgtctagaaaactggataacctcattagcagagtctcaacttcagacccgccaacaa
attaagaaactggaggagttgcagcaaaaagtttcctacaaaggggacccaattgtacag
caccggccaatgctggaggagagaattgtggagctctttagaaacttaatgaaaagtgcc
ttcgtggtcgagcggcagccctgcatgcccatgcatcccgaccggccgttagtcatcaag
accggcgtccagtttactacgaaagtcagattgctggtcaaattccccgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgtagcagctctcagagga
tccaggaaatttaacattctgggcacaaacacaaaagtcatgaacatggaagaatccaac
aatggcagcctctctgcagaattcaaacacttgaccctgagagagcaaagatgtggtaat
gggggccgagccaattgtgacgcctccctgattgtgaccgaagagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctagagacccactccttgcca
gtggtggtgatatccaacatctgtcagatgccaaatgcctgggcatctatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcacgaagcccccaattggaacc
tgggatcaggtggccgaggtgctgagctggcagttctcttccaccacgaagcgagggttg
agcatcgagcagttgactacactggcagagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaatatcattgatcttgtgaaaaagtacattctggccctttgg
aacgaagggtacataatgggctttatcagcaaggaaagagagagggccatcttgagcacc
aagcccccaggcaccttcctgcttagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtcagtggaaccatat
accaagcagcagctgaacaacatgtcgttcgcggaaatcatcatgggctataagatcatg
gatgctaccaatatcctggtgtctccactggtctatctctaccccgacattcctaaagag
gaggcgttcggaaagtattgtcggccagagagccaggagcatcctgaggctgacccaggt
agtgctgccccctacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgagtccctcacattcgacatggag
ctgacctcagagtgcgctacctccccaatgtga

DBGET integrated database retrieval system