KEGG   Miniopterus natalensis: 107529006
Entry
107529006         CDS       T05883                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05219  Bladder cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107529006 (ERBB2)
   04012 ErbB signaling pathway
    107529006 (ERBB2)
   04066 HIF-1 signaling pathway
    107529006 (ERBB2)
   04020 Calcium signaling pathway
    107529006 (ERBB2)
   04151 PI3K-Akt signaling pathway
    107529006 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529006 (ERBB2)
   04520 Adherens junction
    107529006 (ERBB2)
   04530 Tight junction
    107529006 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529006 (ERBB2)
   05206 MicroRNAs in cancer
    107529006 (ERBB2)
   05205 Proteoglycans in cancer
    107529006 (ERBB2)
   05230 Central carbon metabolism in cancer
    107529006 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107529006 (ERBB2)
   05226 Gastric cancer
    107529006 (ERBB2)
   05219 Bladder cancer
    107529006 (ERBB2)
   05215 Prostate cancer
    107529006 (ERBB2)
   05213 Endometrial cancer
    107529006 (ERBB2)
   05224 Breast cancer
    107529006 (ERBB2)
   05223 Non-small cell lung cancer
    107529006 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107529006 (ERBB2)
   01524 Platinum drug resistance
    107529006 (ERBB2)
   01522 Endocrine resistance
    107529006 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107529006 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529006 (ERBB2)
   04090 CD molecules [BR:mna04090]
    107529006 (ERBB2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107529006 (ERBB2)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107529006 (ERBB2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107529006 (ERBB2)
CD molecules [BR:mna04090]
 Proteins
  107529006 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Protocadherin
Other DBs
NCBI-GeneID: 107529006
NCBI-ProteinID: XP_016057755
LinkDB
Position
Unknown
AA seq 1230 aa
MKLQLPASPETHLDMLRHLYQGCQVVQGNLELTYLPANASLFFLQDIQEVQGYVLIAYNQ
VRQVPLQRLRIIRGTQLFEDNYALAVLNNGDLLDGATPVAGAAPGGLRELQLRSLTEILK
GGVSIQQNPQLCHQDTILWKDIFHKNNQLALMKIDTNRSRACQPCSPACEASRCWGESSK
DCQNLTQTVCASGCARCKGPKPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVIYNTDTFESMPNPEGRYTFGASCVTTCPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQR
CEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFEGDPASNTA
PLQPEQLRVFETLEEITGYLYISAWPDSLPDLGVFQNLQVIRGRVLHDGAYSLTLQGLGI
RSLGLRSLRELGSGLALIHRNTHLCFVHTVPWDQLFRNPHQALLHSANRPEDECVGEGLA
CYPLCAHGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVKDRHCLPCHSECQPQ
NGSVTCLGSEADQCMACAHYKDSPFCVARCPSGVKPDLSFMPIWKFPDEEGTCQPCPINC
THSCVELDDKGCPAEQRASPVTSIIAAVVGTLLVMVVGIVLGILIRRRRQKIRKYTMRRL
LQETELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPV
AIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHV
REHRGRLGSQDLLNWCVQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLL
DIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPARE
IPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQ
NEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGTAHRRHRSS
STRSGGGDLTLGLEPSEEEPPKSPLAPSEGAGSDVFDSDLGMGAAKGLQSLSPHDPSPLQ
RYSEDPTVSLPSETDGYVAPLTCSPQPEYVNQPEVRPKPPSPLEGPLPPPRSASATLERP
KTLSPKTLSPGKNGVVKDVFAFGGAVENPEYLAPRSRAAPEPHPPPAFSPAFDNLYYWDQ
DPPERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3693 nt   +upstreamnt  +downstreamnt
atgaagctgcagctcccagccagtcctgagacccacctggacatgctgcgccacctctac
cagggctgtcaggtggtgcagggtaacctggagctcacctacctgcctgccaatgccagt
ctcttctttctacaggatatccaggaggtgcagggctacgtgctcatcgcttacaaccaa
gtgagacaggtcccactgcaaaggctgcgaatcatacgaggcacccaactctttgaggac
aactatgctctggccgtgctgaacaacggagacctgctggacggtgccacccctgttgca
ggggctgccccaggagggctgcgggagctgcagcttcgaagcctcacagagatcctgaag
ggaggggtctcgatccagcagaacccgcagctctgccaccaggacacgattttgtggaag
gacatcttccacaagaacaaccagttggccctcatgaagatagacaccaaccgctcccgg
gcctgccaaccctgttctccagcttgtgaagcctcccgctgctggggagaaagttccaag
gattgtcagaacttgactcaaactgtgtgtgccagtggctgtgcccgctgcaagggcccg
aagcccaccgactgctgccatgagcagtgtgctgctggttgcacgggccccaagcactct
gactgcctggcctgcctccacttcaaccacagtggcatctgtgagctgcactgcccagcc
ctggtcatctacaacacggatacctttgagtccatgcccaacccagagggtcgttacacc
tttggtgccagctgtgtgaccacctgtccctacaactacctgtcaacggatgtgggatcc
tgcaccctggtctgtcccctgaacaaccaagaggtgacagctgaggatggaacacagcgg
tgtgagaaatgcagcaagccctgtgcccgagtgtgctatggtctgggcatggaacacctg
cgggaggtgagggcggtcaccagtgccaatatccaggagtttgccggctgcaagaagatc
tttgggagcctggcatttctgccagagagctttgagggggacccagcctctaacactgcc
cccctacagcctgagcagctcagagtgtttgagaccttggaggagatcacaggttaccta
tacatctcagcgtggccagacagcctgcctgaccttggtgtcttccagaacctgcaagtg
atccggggacgtgttctgcatgatggtgcctactcgctgacgctgcaagggctgggcatc
agatcgctggggctgcgctcgctgcgggaactgggcagtgggctggccctcatccaccgc
aacacccacctctgctttgtacacacggtgccctgggaccagctcttccggaaccctcac
caggccctgctccacagtgccaaccggccagaggatgagtgtgtgggtgagggcctggcc
tgctacccgctgtgcgcccacgggcactgctggggtccggggcccacccagtgcgtcaac
tgcagccagttccttcggggccaggagtgcgtggaggagtgccgagtactgcaggggctc
ccccgggagtatgtgaaggacaggcactgtctgccgtgccactccgagtgtcagccccag
aatggctcagtgacgtgcttaggatcggaggctgaccagtgtatggcctgtgcccactac
aaggactctcctttctgtgtggctcgatgccccagtggtgtgaaacctgacctctccttc
atgcccatctggaagttcccagatgaggagggcacatgccagccgtgccccatcaactgc
acccactcctgtgtggaactggatgacaaaggctgccccgcagagcagagagccagcccc
gtgacatccatcattgctgccgtggtgggcactctgctggtcatggttgtggggatcgtc
ctcggcatcctaatcaggaggcggcggcaaaagatccggaagtacacgatgcggaggctg
ctgcaggaaacggagctggtggagccgctgacacctagtggagcaatgcccaaccaggct
cagatgcggatcctcaaagagacagagctgaggaaggtgaaggtgcttggatccggagcc
tttggcacagtctacaagggcatctggatccctgatggggagaatgtgaagatcccagta
gccatcaaggtgttgagggaaaacacatctcctaaagccaacaaagaaatcctggatgaa
gcatatgtgatggctggtgtgggctccccatatgtgtcacgcctcctgggcatctgcttg
acctccacggtgcagctggtgacacagcttatgccctatggctgcctcctagaccacgtc
cgagaacaccgcgggcgcctgggctcccaggacctgctgaactggtgtgtgcagattgcc
aagggaatgagctatttggaggacgtgcggctcgtgcacagggacctggctgcccggaat
gtgctggtcaagagtcccaaccacgtcaagatcacagactttgggctggctcgactactg
gacattgatgagacagagtaccatgcggatgggggcaaggtgcccatcaagtggatggcg
ctggagtccattctccgccgacggttcacccaccagagtgatgtgtggagctatggtgtg
actgtgtgggagctgatgacttttggggccaagccttacgatgggatcccagcccgggag
atccctgacctactggagaagggggaacggctgccccagccccctatctgcaccatcgac
gtctacatgatcatggtgaaatgttggatgattgactctgaatgtcggcctcggttccgg
gagttggtgtctgaattctcccgcatggccagggacccccaacgctttgtggtcatccag
aatgaggacttgggccctgctagccccttggacagcaccttctaccgatcactgctggaa
gatgacgacatgggggacctggtggatgctgaggagtacctggtaccccagcaaggcttc
ttctgcccagaccctgccccgggtgctgggggcacagcccaccgcaggcatcgcagctca
tccaccaggagtggcggtggtgatctgacactggggctagagccctctgaggaagagccc
cccaagtctccactggcaccctccgaaggggcaggctctgatgtgtttgacagcgacttg
ggtatgggggcagccaagggactgcagagcctctccccacatgaccccagccctctacag
cggtacagtgaggaccccacagtatccctgccctccgagactgatggctatgttgccccc
ctgacctgcagcccccagccagaatatgtgaaccagccagaggttcgcccgaagcccccc
tcacccctggagggccctctgcctcctcctcgatctgccagtgccactctggaaaggccc
aagactctctcccccaagactctctcccctgggaagaacggggttgtcaaagacgttttt
gcctttgggggtgccgtggagaatcctgagtacttggcaccccgcagcagggctgcccct
gagccccaccctcctccagccttcagcccagcctttgacaacctctattactgggaccag
gacccaccagagcggggctctccacccagcacctttgaagggacccctacagcagagaac
cctgagtacctgggcctggatgtgccagtatga

DBGET integrated database retrieval system