KEGG   Miniopterus natalensis: 107529056
Entry
107529056         CDS       T05883                                 

Gene name
ATP1B1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107529056 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    107529056 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107529056 (ATP1B1)
   04918 Thyroid hormone synthesis
    107529056 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    107529056 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    107529056 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107529056 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    107529056 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    107529056 (ATP1B1)
   04971 Gastric acid secretion
    107529056 (ATP1B1)
   04972 Pancreatic secretion
    107529056 (ATP1B1)
   04976 Bile secretion
    107529056 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    107529056 (ATP1B1)
   04974 Protein digestion and absorption
    107529056 (ATP1B1)
   04978 Mineral absorption
    107529056 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107529056 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107529056 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    107529056 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107529056 (ATP1B1)
CD molecules [BR:mna04090]
 Proteins
  107529056 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107529056
NCBI-ProteinID: XP_016057824
LinkDB
Position
Unknown
AA seq 505 aa
MAFSVMQMNKALDEGKKADYSISGIGELRKHTDLECGVWRKTVPVEDLESKESFKGGTML
NQNGSDPHWAPSLNGAASILEPRQHSPGFHIHVESETPEDPRYTTGRSLSGGVSHRSTHK
TGRAVHVAPGLRRRRTSRGTEESGQVAGSGQSFGGFDHVLCVMGNIPPIAATFASLLIRT
HVLHAVFTLPSGILSPLSRLAGAALPCGRLPREGSLGAGRLSAPSKPGGPAAALVKILLF
YVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQVPQIQKTEISFRMGEAKSY
EAYVRSMVRFLEKYKDSAQKDDMIFEDCGSVPSEYKDRGGYDSDPGERKVCRFKLEWLGN
CSGINDESFGYKEGKPCIIIKLNRVLGFKPKPPKNETLEGLPMLKYSPNVLPVQCTGKRD
EDKDKVGSVEYFGLGRQPGFPLQYYPYYGRLLQPKYLQPLLAVQFTNLTLDTEVRVECKA
YGENIGYSEKDRFQGRFDLKIEVKS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcattttctgtgatgcaaatgaacaaagctcttgatgaaggaaagaaagccgactat
tcaatctctggaattggtgagctaagaaagcacactgacctcgagtgtggggtctggagg
aaaacggtgcccgtggaggacctggagtccaaggagagtttcaaaggggggacgatgctc
aatcagaatggcagtgacccccactgggctcccagcttgaatggtgcagcatccatcctc
gaacccaggcaacactcgcccggctttcacatccacgttgagtccgagacccccgaagac
cctcgatacaccacaggacgttcactgagcgggggtgtcagccaccggagcacgcacaaa
acggggagggctgtccacgtggctcctggtctccgcagaaggcgcacgtcccgcggcacc
gaggagagcggtcaggtggccggctccggccaaagttttggaggttttgaccacgtgctc
tgtgtcatgggcaacattccgccaatcgcagcgacgtttgcctcacttctaatccgcacc
cacgtccttcacgccgtgttcactctcccgagcggcatcctcagccccctaagcagacta
gcgggagccgccttgccgtgcggtcggcttcccagggaaggctccctgggggctggtcgg
ctgtctgcaccttccaagcccgggggcccggctgccgctctggttaagatccttctgttc
tacgtgatattttacggctgcctggctggcatcttcatcggaaccatccaagtgatgctg
ctcacgatcagtgaatttaagcccacctatcaggaccgagtggccccgccaggactgacg
caggttcctcagatccaaaagaccgaaatctccttccgcatgggcgaggccaagagctac
gaggcgtatgtgcggagcatggttcgcttcctggagaagtacaaggattctgcccagaag
gacgacatgatttttgaagattgtggcagtgtgcccagcgaatacaaagaccgaggaggc
tacgacagtgacccaggcgagcggaaggtctgcaggttcaagctcgagtggctgggaaac
tgctctgggataaacgacgaatcatttggctacaaagagggcaagccctgcatcatcata
aagctcaacagggtcctgggcttcaaacctaagcctcccaagaatgagaccttggagggt
cttccgatgctgaagtacagccccaatgtcctgcccgtccagtgcaccggcaagcgcgac
gaagacaaagataaagtggggagcgtggagtacttcggcctgggccgccagcccggcttc
cccctgcagtactacccctactacggccggctcctgcagcccaagtacctgcagcccctg
ctggccgtgcagttcaccaacctcacgctggacacggaggtccgcgtggagtgcaaggcc
tacggggaaaacatcggctacagcgagaaggaccgcttccaggggcgcttcgacttgaag
atcgaggttaagagctga

KEGG   Miniopterus natalensis: 107530783
Entry
107530783         CDS       T05883                                 

Gene name
FXYD2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit gamma
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107530783 (FXYD2)
   04022 cGMP-PKG signaling pathway
    107530783 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107530783 (FXYD2)
   04918 Thyroid hormone synthesis
    107530783 (FXYD2)
   04919 Thyroid hormone signaling pathway
    107530783 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107530783 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    107530783 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    107530783 (FXYD2)
   04972 Pancreatic secretion
    107530783 (FXYD2)
   04976 Bile secretion
    107530783 (FXYD2)
   04973 Carbohydrate digestion and absorption
    107530783 (FXYD2)
   04974 Protein digestion and absorption
    107530783 (FXYD2)
   04978 Mineral absorption
    107530783 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107530783 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107530783 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    107530783 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530783 (FXYD2)
   04147 Exosome [BR:mna04147]
    107530783 (FXYD2)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107530783 (FXYD2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107530783 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 107530783
NCBI-ProteinID: XP_016060181
LinkDB
Position
Unknown
AA seq 64 aa
MDRWSLGGSPKGDMDPFYYDYETVRNGGLIFAGLAFVVGLIIILSKRLRCGGKKKHRPGS
EDEL
NT seq 195 nt   +upstreamnt  +downstreamnt
atggacaggtggtccctgggtggcagccccaagggggatatggacccattctactatgac
tatgagactgtccgcaatgggggcctgatctttgctggcctggccttcgtggtggggctc
atcataatactcagcaaaagactccgctgtggggggaaaaagaagcaccggcccggcagc
gaggacgagctgtaa

KEGG   Miniopterus natalensis: 107534181
Entry
107534181         CDS       T05883                                 

Gene name
ATP1A3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107534181 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    107534181 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107534181 (ATP1A3)
   04918 Thyroid hormone synthesis
    107534181 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    107534181 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    107534181 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534181 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    107534181 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    107534181 (ATP1A3)
   04971 Gastric acid secretion
    107534181 (ATP1A3)
   04972 Pancreatic secretion
    107534181 (ATP1A3)
   04976 Bile secretion
    107534181 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    107534181 (ATP1A3)
   04974 Protein digestion and absorption
    107534181 (ATP1A3)
   04978 Mineral absorption
    107534181 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107534181 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107534181 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    107534181 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107534181 (ATP1A3)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107534181 (ATP1A3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107534181 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   107534181 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   107534181 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   107534181 (ATP1A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107534181
NCBI-ProteinID: XP_016064662
LinkDB
Position
Unknown
AA seq 1027 aa
MGSGDSDSYRVATSQDKKDDKSSPKKSKAAKERRDLDDLKKEVAMTEHKMSVEEVCRKYN
TDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYG
IQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGE
KMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNP
LETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLIT
GVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNC
LVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSH
TWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKK
VAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKE
AFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPR
AAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVN
PRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTG
DGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSI
AYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQP
RNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVN
DLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIF
GLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGW
VEKETYY
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggggtctggtgactctgacagctatcgtgtcgccacctcgcaggacaagaaagatgac
aagagttcgcctaagaagagcaaggccgccaaggagcgccgggacttggatgacctgaag
aaggaggtggcaatgaccgagcacaagatgtcagtggaggaggtctgtcggaagtacaac
acggactgcgtgcagggtctgacccacagcaaagcccaggagatcctggcccgggacggg
cctaatgcgctcacgccgccgcccaccaccccggagtgggtcaagttctgccgccagctc
ttcgggggcttctctatcctgctctggatcggggccatcctctgcttcctggcctacggc
atccaggcgggcaccgaggacgatccctctggggacaatctgtacctgggcatcgtgctg
gcagccgtggtcatcatcaccggctgcttctcctactaccaggaggccaagagctccaag
atcatggagtccttcaagaacatggttccccagcaagccctggtgatccgggaaggtgag
aagatgcaggtgaatgctgaggaagtggtggtcggggacctggtggagatcaagggcggg
gaccgagtcccagcagaccttcggattatctcagcgcacggctgcaaggtggacaactcc
tccctgaccggcgaatcagaaccccagacccgctctcccgactgcacacatgacaacccc
ttggagactcggaacattaccttcttttccaccaactgcgtggaaggcacggctcgaggg
gtggtggtggccacaggggaccgtactgtcatgggccgcattgccaccctggcttcaggg
ctggaggtgggcaagacgcccatcgccatcgagattgagcacttcatccagctcatcacg
ggcgtggccgtcttcctgggggtctccttcttcgtgctctccctcattcttggatacagc
tggctggaggctgtcatcttcctcatcggcatcatcgtggccaatgtcccagagggcctg
ctggccactgtcactgtgtgtctgacactgacagccaagcgcatggcccggaagaactgc
cttgtgaaaaacctggaggctgtagagaccctgggctccacatccaccatctgctcggac
aagacagggaccctcacccagaaccgcatgacagttgcccacatgtggttcgacaaccag
atccatgaggccgacaccactgaggaccagtcaggaacctcgttcgacaagagctcgcac
acctgggtggccctgtcccacatcgccggactctgcaatcgggccgtcttcaagggtggt
caggacaacatccctgtgctcaagagggatgtggccggcgatgcctccgaatcggccctg
ctgaaatgcatcgagttgtcctccgggtctgtgaagctgatgcgggaacggaacaagaaa
gtcgccgagatcccctttaactccaccaacaaataccagctctccatccatgagaccgag
gaccccaacgacaaccggtacctgctggtgatgaagggcgcccctgagcgcatcctggac
cgctgctccaccatcctgctgcagggcaaggagcagccgctggacgaggagatgaaggaa
gccttccagaacgcctaccttgagcttggtggcctgggcgagcgtgtgctgggtttctgc
cattactacctgcctgaggagcagttccccaagggctttgcctttgactgcgacgacgtg
aacttcaccacagacaacctctgctttgtgggcctcatgtccatgattgacccgccccgg
gcagccgtccccgacgcagtgggcaagtgccgcagcgcaggcatcaaggtcatcatggtc
acaggcgatcaccccatcacagcaaaggccattgccaagggcgtgggcatcatctctgag
ggcaacgagactgtggaggacattgctgcccggctcaacattccggtcagccaggtcaac
ccccgggacgccaaggcctgtgtgatccacggcaccgacctcaaggacttcacctccgag
cagatcgacgagatcctgcagaaccacaccgagatcgtcttcgcccgcacatcgccccag
cagaagctcatcatcgtggagggctgtcagagacagggggcaatcgtggcagtgactggg
gacggcgtgaatgactcccccgctctgaagaaggccgacatcggggtagccatgggcatc
gccggctctgatgtctccaagcaggcagccgacatgattctgctggacgacaactttgcc
tccattgtcaccggcgtggaggagggccgcctgatctttgacaacctgaagaagtccatc
gcctacaccctgaccagcaacatccctgagatcacacccttcctactgttcatcatggcg
aacatcccgctgcctctgggcaccattaccatcctctgcatcgacctgggcaccgacatg
gtccctgccatctcattggcatatgaggctgccgagagtgacatcatgaagagacagccc
aggaatccacgcactgataagctggttaacgagaggctcatcagcatggcctacgggcag
attggaatgatccaggctcttggcggctttttctcttacttcgtgatcctggcagaaaac
ggtttcttgcccggcaacctggtgggcatccggctgaactgggatgaccgcaccgtcaat
gacctcgaggacagttatgggcagcagtggacctatgagcagcggaaggtggtggagttc
acgtgccacacggccttcttcgtgagcatcgtcgtggtgcagtgggccgacctgatcatc
tgcaagacccgcaggaactcggtcttccagcagggcatgaagaacaagatcctgatcttc
ggcttgtttgaggagacggcccttgctgccttcctttcctactgccctggcatggacgtg
gccctccgcatgtaccctctcaagcccagctggtggttctgtgccttcccctacagcttc
ctcatcttcgtctatgacgaaattcgcaaactcatcctgcgcaggaaccccgggggttgg
gtggagaaggaaacctactactga

KEGG   Miniopterus natalensis: 107534499
Entry
107534499         CDS       T05883                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3-like
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107534499
   04022 cGMP-PKG signaling pathway
    107534499
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107534499
   04918 Thyroid hormone synthesis
    107534499
   04919 Thyroid hormone signaling pathway
    107534499
   04925 Aldosterone synthesis and secretion
    107534499
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534499
   04261 Adrenergic signaling in cardiomyocytes
    107534499
  09154 Digestive system
   04970 Salivary secretion
    107534499
   04971 Gastric acid secretion
    107534499
   04972 Pancreatic secretion
    107534499
   04976 Bile secretion
    107534499
   04973 Carbohydrate digestion and absorption
    107534499
   04974 Protein digestion and absorption
    107534499
   04978 Mineral absorption
    107534499
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107534499
   04961 Endocrine and other factor-regulated calcium reabsorption
    107534499
   04964 Proximal tubule bicarbonate reclamation
    107534499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107534499
CD molecules [BR:mna04090]
 Proteins
  107534499
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107534499
NCBI-ProteinID: XP_016065111
LinkDB
Position
Unknown
AA seq 281 aa
MMKKDKKTFNQSLAKWKLFIYNQTTGEFLGRTGKSWGLILLFYVVFYGFLAALLIFAMWL
MLQTLNDEVPKYRDQIPNPGLTVFPKPVSALEYSFSMSEPESYKGYIEDLKNFLKPYASE
EQKTLRLCPDGQLFHQEGPVYQACQFPLDLLEECSGVKDPNFGYSSGNPCILVKMNRIIG
LKPQGEPKISCSGSSKGGNMTAVLTYPPDGHMDLKYFPYYGKKLHVSYLQPLVAVQLSLG
ASKTPKEVTVECKIVGSPNLKNHDDRDKFLGQVVFKITMRA
NT seq 846 nt   +upstreamnt  +downstreamnt
atgatgaagaaagacaagaagaccttcaaccagagcctggccaagtggaagctcttcatc
tacaaccagaccactggagagttcctggggcgcacaggcaagagctggggtttgatcttg
ctcttctacgtagtcttttatgggttcctggctgcactcctcatattcgcaatgtggctt
atgcttcagactctgaacgatgaggttccaaaataccgagaccagattcctaatccagga
cttacggtttttccaaaaccagtgtcggcgttagaatattcattcagtatgtctgaacca
gagtcctataaagggtacattgaagaccttaagaactttctgaagccatatgcttcggaa
gaacagaagactctccgactctgcccggatggacagctctttcatcaggagggtccggtt
tatcaagcatgtcagtttcctcttgacttacttgaggaatgcagtggggtgaaggaccct
aactttggctactccagtgggaacccttgtattcttgtaaaaatgaacagaataattggt
ttaaagcctcaaggtgaaccgaagatatcatgctctggtagttctaagggtggaaacatg
acagctgtattaacttatcctccagatggacatatggacttaaaatattttccatattat
gggaaaaaactgcatgtgagttatctacagccattagttgctgtccaactcagcctcggt
gctagcaaaaccccaaaagaagtaacagtcgagtgcaagattgttggatcacccaacctg
aaaaaccatgatgatcgtgacaagtttttaggacaagttgtatttaaaatcacaatgcgt
gcatag

KEGG   Miniopterus natalensis: 107534704
Entry
107534704         CDS       T05883                                 

Gene name
ATP1B3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107534704 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    107534704 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107534704 (ATP1B3)
   04918 Thyroid hormone synthesis
    107534704 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    107534704 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    107534704 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107534704 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    107534704 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    107534704 (ATP1B3)
   04971 Gastric acid secretion
    107534704 (ATP1B3)
   04972 Pancreatic secretion
    107534704 (ATP1B3)
   04976 Bile secretion
    107534704 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    107534704 (ATP1B3)
   04974 Protein digestion and absorption
    107534704 (ATP1B3)
   04978 Mineral absorption
    107534704 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107534704 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107534704 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    107534704 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107534704 (ATP1B3)
CD molecules [BR:mna04090]
 Proteins
  107534704 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107534704
NCBI-ProteinID: XP_016065354
LinkDB
Position
Unknown
AA seq 259 aa
MCVSPNFISLFSFTGLILLFYLVFYGFLAALFTFTMWVMLQTLNDEVPKYRDQIPSPGLM
VFPKPVSALEYSFSMSEPESYKGYIEDLKNFLKPYASEEQKNLRLCPDGQLFHQEGPVYQ
ACQFPLDLLEECSGVKDPNFGYSSGNPCILVKMNRIIGLKPQGEPKISCSGSSKGGNMTA
ILTYPPDGHMDLKYFPYYGKKLHVSYLQPLVAVQLSLNANKTPKEVTVECKIVGSPNLKN
HDDRDKFLGRVVFKITMRA
NT seq 780 nt   +upstreamnt  +downstreamnt
atgtgtgtatctccaaatttcataagtttattttctttcacaggtttgatcttgctcttc
tacctagtcttttatgggttcctggctgcactcttcacattcacaatgtgggttatgctt
cagactctgaacgatgaggttccaaagtaccgagaccagattcctagtccaggacttatg
gtttttcctaaaccagtgtcggcgttagagtattcattcagtatgtctgaaccagagtcc
tataaagggtacattgaagaccttaagaactttctgaagccatatgcttcggaagaacag
aagaatctccgactctgcccggatggacagctctttcatcaggagggtccggtttatcaa
gcatgtcagtttcctcttgacttacttgaggaatgcagtggggtgaaggaccctaacttc
ggctactccagtgggaacccttgtattcttgtaaaaatgaacagaataattggattaaag
cctcaaggtgaaccgaagatatcatgctctggtagttctaagggtggaaacatgacagct
atattaacttaccctccagatggacatatggacttaaaatattttccatattatgggaaa
aaactgcatgtgagctatctacagccattagttgctgtccaactcagcctcaatgctaac
aaaaccccaaaagaagtaacagtcgagtgcaagattgttggatcacccaacctgaaaaac
catgatgatcgtgacaagtttttaggacgagttgtgttcaaaatcacaatgcgtgcatag

KEGG   Miniopterus natalensis: 107537932
Entry
107537932         CDS       T05883                                 

Gene name
ATP1B4
Definition
(RefSeq) protein ATP1B4 isoform X1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107537932 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    107537932 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107537932 (ATP1B4)
   04918 Thyroid hormone synthesis
    107537932 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    107537932 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    107537932 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107537932 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    107537932 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    107537932 (ATP1B4)
   04971 Gastric acid secretion
    107537932 (ATP1B4)
   04972 Pancreatic secretion
    107537932 (ATP1B4)
   04976 Bile secretion
    107537932 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    107537932 (ATP1B4)
   04974 Protein digestion and absorption
    107537932 (ATP1B4)
   04978 Mineral absorption
    107537932 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107537932 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107537932 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    107537932 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107537932 (ATP1B4)
CD molecules [BR:mna04090]
 Proteins
  107537932 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase DUF2721
Other DBs
NCBI-GeneID: 107537932
NCBI-ProteinID: XP_016069542
LinkDB
Position
Unknown
AA seq 300 aa
MRRQLRSRRAPAFPHSYRYRLDDQDEVNQNYLADEEEEAEEEARMQKLRLREGLILVIYF
FFYASLAAVITLCMYTLFLTIGPYMPTFSERVKPPGVMIRPFAHSLNFNFNVSEPDTWQH
YVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPT
FGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYP
YYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagaaggcagctccggtccagaagggctccggcctttcctcacagttatcgctacaga
cttgatgaccaagatgaagtgaatcagaactacttagcagatgaagaggaagaagcagaa
gaagaggctcggatgcagaaactgaggcttagagagggcctgatcttagtcatttacttc
tttttctacgcttctctggctgctgtgatcactctctgcatgtacacgctatttctgacc
attggcccttacatgccaaccttctctgagagggtgaagcctcctggagttatgatcaga
cccttcgcccatagccttaacttcaacttcaacgtttctgaacctgacacttggcagcat
tatgtgattagcctaaatggctttctccagggttataatgacagtcttcaagaggaaatg
aatgtagattgtcccccgggacagtacttcatccaagatggaaatgaagatgaggacaag
aaggcctgccaatttaagcgctctttcctgaagaattgctctggcctggaagaccctact
tttggctactctactggacagccctgcattcttctaaagatgaacaggattgtaggcttt
cgtcctgagcttggagatcctgtgaaggtttcctgcaaagttcagagaggtgatgaaaat
gacatccgatccatcaattactacccagagtctgcttcttttgacctccgctactaccct
tactacggcaaattgactcacgttaactacacctccccactggtggcaatgcattttaca
gatgtggtgaagaaccaagcggtgcctgtgcagtgccaactgaagggcaaaggcatcata
aatgatgtcatcaatgatcgctttgtgggtagggtaatctttactctgaacatagaaacc
taa

KEGG   Miniopterus natalensis: 107538456
Entry
107538456         CDS       T05883                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107538456
   04022 cGMP-PKG signaling pathway
    107538456
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107538456
   04918 Thyroid hormone synthesis
    107538456
   04919 Thyroid hormone signaling pathway
    107538456
   04925 Aldosterone synthesis and secretion
    107538456
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107538456
   04261 Adrenergic signaling in cardiomyocytes
    107538456
  09154 Digestive system
   04970 Salivary secretion
    107538456
   04971 Gastric acid secretion
    107538456
   04972 Pancreatic secretion
    107538456
   04976 Bile secretion
    107538456
   04973 Carbohydrate digestion and absorption
    107538456
   04974 Protein digestion and absorption
    107538456
   04978 Mineral absorption
    107538456
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107538456
   04961 Endocrine and other factor-regulated calcium reabsorption
    107538456
   04964 Proximal tubule bicarbonate reclamation
    107538456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538456
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107538456
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107538456
  Exosomal proteins of other body fluids (saliva and urine)
   107538456
  Exosomal proteins of colorectal cancer cells
   107538456
  Exosomal proteins of bladder cancer cells
   107538456
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD DUF1290
Other DBs
NCBI-GeneID: 107538456
NCBI-ProteinID: XP_016070203
LinkDB
Position
Unknown
AA seq 1028 aa
MGLGGAKGTVTPQEQNPSPRPKKGPKRGKMRMKKKKKKIDMEELKKEVVMNDHKLTLEQL
STKYSVDLTKGLSPKEAQEILDRDGPNTLTPPPTTPEWIKFCRQMFGGFSILLWIGAILC
FTAYGIQVSFHEETTEDNLYLGIVLAVVVFITGCFSYSQEAKSSRIMESFKNMVPQQALV
IRGGEKMQINVQNVVVGDLVEVKGGDRIPADIRLISAQGCKVDNSSLTGESEPQTRSPDF
THENPLETRNICFFSTNCVEGTARGIVIATGDSTAMGRIATLTSSLGVGKTPIAVEIEHF
IHLITSLAIFLGIAFFVLSIILGYGWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRM
ARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWFDKTIYAADTNEEQTGNAF
ANSSDTWSILARIAGLCNRADFGTDQEALPVAKRTTTGDASESALLKFVEQTYSSVKEMR
EKSPKVAEIPFNSTNKYQMSIHLREDSSQAHVLLMKGAPERILEFCSSYFLNGQEYPMDN
EMKEAFQNAYLELGGLGERVLGFCFLNLPTTFSKGFKFNVDEINFPMTNLCFAGLMSLID
PPRAAVPDAVNKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGSETAEDIAARLKVPVT
EIRDAKAIVVHGSKLKEMNTEELANVLRNHMEIVFARTSPQQKLIIVEGCQRLGAIVAVT
GDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKS
IAYTLTSNIPEITPFLLFIILSIPLPLGTITILCIDLGTDMLPAISLAYETAESDIMKRA
PRNPKTDNLVNQRLISMAYGQIGMIQALAGFFTYFVILAENGFKPFDLLGIRIDWENRYI
NDLEDSYGQQWTYEQRKVVEFTCQTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLI
CGILEETLLAAFLSYTPGMDLAMRMYPLKILWWLCATPYSLLIFVYDEMRKLAIRHHPGG
WVERETYY
NT seq 3087 nt   +upstreamnt  +downstreamnt
atggggcttgggggtgcaaagggaacagtgactcctcaggagcagaatcccagcccaaga
cctaaaaaagggccaaaaaggggtaaaatgaggatgaagaagaaaaagaagaagatagat
atggaggagctgaagaaggaagtggtcatgaacgatcacaaattaaccttggaacagctg
agcaccaagtattctgtggacctgacaaagggccttagccccaaagaggcacaggaaatc
ctggatcgagatggacccaatacactcacgccaccccccaccactccagaatggatcaaa
ttctgtagacaaatgtttggtggcttctccattctcctgtggattggtgccattctctgc
tttacggcttatggcatccaggtgtcttttcatgaggagactaccgaagacaatctgtac
ctgggcattgtattagctgttgtggtgttcatcacgggctgcttctcctacagtcaggag
gccaagagttccagaatcatggagtcttttaagaacatggtgcctcagcaagctctagta
attcgaggtggagagaagatgcagataaatgtacagaatgtagtggtgggagacctggta
gaagtgaagggtggagaccgaatccccgctgacatccggctcatctctgcacaaggatgt
aaggtggacaactcatccttgacgggagagtcggagccccagacccgcagccctgatttc
acccatgagaaccctctggaaacccgaaacatctgcttcttctccaccaactgtgtggaa
ggaacagcccggggcatcgtgattgctacaggagactccacagccatgggccgcattgcc
accctgacctcaagcctgggagttggcaagactcccattgctgtagaaatcgaacacttt
atccatctgatcacctcgctggccatcttccttggcatcgcgttctttgtgctctccatt
atcttgggctacggctggctggaggctgtcatttttcttattggcatcattgtggccaat
gtccctgaggggctgctggccactgtcactgtgtgtctgacgctgacagccaagcgcatg
gcgaggaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacctcc
accatctgctccgacaagacgggcaccctcacccagaaccgtatgaccgtcgcccactta
tggttcgataagaccatctatgcagctgacacgaatgaagaacagactgggaatgcattt
gccaacagctctgacacctggtccatcctggcccgaatcgctggcctctgcaaccgggct
gactttgggactgatcaggaggcccttcccgtagcgaagcgcacaacaacaggggatgct
tccgagtcagccctcctcaagttcgtcgagcagacctacagctctgtgaaggagatgagg
gagaaaagccccaaggtggcagagattccctttaattctaccaacaagtaccagatgtcc
atccacctccgggaagacagttcccaggcccacgtgctgctgatgaagggggctcctgag
aggatcttggagttttgctctagttactttctgaatgggcaagagtacccaatggacaat
gaaatgaaagaagccttccagaacgcctacctggaactggggggtctgggggaacgtgtg
ctagggttctgcttcttgaatctgcctaccactttctccaagggattcaagtttaatgtg
gacgaaatcaatttccccatgactaacctttgtttcgcggggctcatgtccttgatcgac
ccccctcgagctgcagtgcctgatgctgtgaacaagtgtcgcagtgcagggattaaggtg
attatggtaacaggggatcatcccattacggccaaggccattgccaagggtgtgggcatc
atctcagaaggttctgagacagcagaggacattgctgcccggctcaaggtccctgtcact
gagatcagggacgccaaagccattgtggtgcatggctcaaaactaaaggaaatgaacaca
gaagaacttgctaatgtcctcagaaaccacatggagattgtgtttgctcggacctcccct
cagcagaagctcatcattgtagagggatgtcagaggctgggagccatcgtggcggtgacg
ggagacggcgtgaatgactccccggcgctgaagaaggctgacatcggcatagccatgggc
atcgctggctccgacgtctctaagcaggcagccgacatgatcctgctggacgacaacttt
gcctccatcgtcacgggcgtggaggagggccgcctcatctttgacaacctgaagaaatcc
attgcgtacaccctgaccagcaacatccccgagatcacccccttcctgctgttcatcatc
ctcagcatccccctgccgctgggcaccataacgatcctctgcatcgacctgggcactgac
atgctcccggctatctccttggcttatgagacagctgaaagtgacatcatgaagagggct
ccacggaatccaaagactgataatctggtgaaccaacgtctcatcagcatggcctatgga
cagattgggatgattcaggctctggctggattctttacctactttgtgattctggctgaa
aatggttttaagccttttgatctgctgggcatccgcatagactgggaaaatcgatacatc
aatgatctggaggacagctatggacagcaatggacctatgagcagcgcaaggtggtggag
ttcacctgccagacggccttctttgtcagcatcgtggtggtgcagtgggccgacctcatc
atctgcaagacccgccgcaactcggtcttccagcagggcatgaaaaacaaggtcctaata
tgtggcatcctagaggagacattactggctgcttttctgtcctacactccaggcatggac
ttggccatgcgaatgtacccactcaagatattatggtggctctgtgccactccctacagc
cttctcatctttgtctatgatgaaatgagaaaattggccattcgtcatcatcctggcggc
tgggtggaaagggagacctactactaa

KEGG   Miniopterus natalensis: 107544529
Entry
107544529         CDS       T05883                                 

Gene name
ATP1B2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107544529 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    107544529 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107544529 (ATP1B2)
   04918 Thyroid hormone synthesis
    107544529 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    107544529 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    107544529 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107544529 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    107544529 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    107544529 (ATP1B2)
   04971 Gastric acid secretion
    107544529 (ATP1B2)
   04972 Pancreatic secretion
    107544529 (ATP1B2)
   04976 Bile secretion
    107544529 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    107544529 (ATP1B2)
   04974 Protein digestion and absorption
    107544529 (ATP1B2)
   04978 Mineral absorption
    107544529 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107544529 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107544529 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    107544529 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107544529 (ATP1B2)
CD molecules [BR:mna04090]
 Proteins
  107544529 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107544529
NCBI-ProteinID: XP_016077918
LinkDB
Position
Unknown
AA seq 290 aa
MVTQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYFVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVTVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGSFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcacccaaaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgcggacgcaccagttcatgggccgcaccgggaccagctgggccttcatc
ctcctcttctacttcgtcttctacggcttcctcacagccatgttcacccttaccatgtgg
gtgatgctgcagactgtctctgaccatacccccaagtaccaggaccgactggccacacca
ggcttgatgattcgtcccaagactgagaaccttgatgtcactgtcaacgtcagtgatact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggagccttacaatgactcc
atccaagcccaaaagaatgatgtctgccgccctgggcgctattacgaacagccagataat
ggagtcctcaactacccgaaacgtgcctgccagttcaaccggacccagctgggtgactgc
tctggcatcggggaccccacccactatggttatagcactgggcagccctgtgtcttcatt
aagatgaaccgggtcatcaacttctatgcaggagcaaaccagagcatgaatgttacctgt
gtggggaagcgagacgaagacgctgagaatctgggcagctttgtcatgttccctgccaat
ggcaacattgacctcatgtacttcccctactatggcaaaaagttccacgtgaactacaca
cagcccctggtggctgtgaagttcctgaacgtgacccctaatgtggaggtgaatgtggaa
tgccggatcaacgcagccaacatcgccacggacgatgaacgagacaagtttgctggccga
gtggcctttaaactccgcatcaacaaaacctga

KEGG   Miniopterus natalensis: 107545330
Entry
107545330         CDS       T05883                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04911  Insulin secretion
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04960  Aldosterone-regulated sodium reabsorption
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04964  Proximal tubule bicarbonate reclamation
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04973  Carbohydrate digestion and absorption
mna04974  Protein digestion and absorption
mna04976  Bile secretion
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107545330 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    107545330 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107545330 (ATP1A1)
   04918 Thyroid hormone synthesis
    107545330 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    107545330 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    107545330 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107545330 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    107545330 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    107545330 (ATP1A1)
   04971 Gastric acid secretion
    107545330 (ATP1A1)
   04972 Pancreatic secretion
    107545330 (ATP1A1)
   04976 Bile secretion
    107545330 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    107545330 (ATP1A1)
   04974 Protein digestion and absorption
    107545330 (ATP1A1)
   04978 Mineral absorption
    107545330 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107545330 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107545330 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    107545330 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545330 (ATP1A1)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107545330 (ATP1A1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545330 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   107545330 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   107545330 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   107545330 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107545330
NCBI-ProteinID: XP_016078893
LinkDB
Position
Unknown
AA seq 1021 aa
MAFKVGRDKYEPAAVSEHGNKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTSARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIQLITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALS
RIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRDRYVKIVEIPF
NSTNKYQLSIHKNPNTAEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLLLPDEQFPEGFQFDTDEVNFPVENLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPINLLGIRVDWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRSPGGWVEKETY
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggcctttaaggttggacgtgacaaatatgagcctgcggctgtttcggagcatggcaac
aagaaaaaggccaagaaagagagggatatggacgagctaaagaaggaagtgtctatggat
gaccataaacttagccttgacgaacttcatcgcaagtacggaacagacttgagccgaggc
ttaaccagcgctcgagctgctgagatcctggcccgcgacggtcccaacgccctcactccc
cctcccaccacccccgagtgggtcaaattctgtcggcagctgtttggggggttctcaatg
ttactgtggattggagcgattctctgtttcttggcttacggcatccaagctgccacggaa
gaggagcctcagaatgataatctgtacctcggcgtggtgctgtctgcggtcgtcatcatt
accggttgtttctcctactaccaagaagctaaaagttcgaagatcatggaatccttcaaa
aacatggttccgcagcaagccctggtgattcgaaatggtgaaaaaatgagcataaatgca
gaggaggttgttgttggggatctggtggaagtgaaaggcggggatcggatccctgccgat
ctcaggatcatatctgcaaacggctgcaaggtggataactcctcactcaccggggaatca
gaaccccagaccaggtctccggatttcacgaatgaaaaccccctggagacgaggaacatt
gccttcttttcaaccaactgcgttgaagggactgcccgcggtattgtcgtgtacaccggg
gatcgcaccgtgatgggaagaatcgccacgctggcttcggggctggaaggcggccagacc
cccattgccgcggagatcgagcatttcatccagctcatcacgggggtggcggtgttcctg
ggggtgtccttcttcatcctgtcactgatcctcgagtacacctggttggaggctgtcatc
ttcctcatcgggatcattgtagccaatgtgcctgaaggtctgctggccactgtcacggtg
tgtctgaccctcactgccaaacgcatggcgaggaagaactgcctcgtgaaaaacctagag
gctgtggagaccttggggtccacatccaccatctgctctgataagactggaaccctgact
cagaaccggatgaccgtggctcacatgtggtttgacaatcagatccatgaggctgacacg
actgagaaccagagtggtgtctcgttcgacaagacctcagccacgtggcttgccctgtcc
agaatcgccgggctgtgtaacagggccgtgtttcaggctaaccaggaaaacctgcccatc
cttaagcgggcggtggctggcgatgcctccgagtcggcgctcctgaagtgcatcgagctg
tgctgcgggtccgtgaaggagatgagggaccgatacgtcaagatcgtggagatacccttc
aactccaccaacaagtaccagttgtccatccataagaaccccaacacggcggagccccga
catctgctggtgatgaagggcgccccggaacggatcctggaccgctgcagctccatcctg
ctgcatggcaaggagcagcccctggacgaagagctgaaggacgccttccagaacgcctac
ctggagctgggcggcctgggggagcgcgtgctgggtttctgccaccttttgctgcccgat
gaacagtttcccgaaggcttccagtttgacaccgatgaggtgaatttccctgtggagaac
ctctgctttgtcgggctcatctccatgatcgaccctccgcgggctgccgtccccgatgcc
gtgggcaagtgccggagcgctgggattaaggtcatcatggtcaccggagaccatccaatc
acagccaaagccattgccaaaggtgtgggcatcatctcagagggcaacgagaccgtggaa
gacattgctgcccgcctcaacatccccgtgagccaggtgaaccccagagacgccaaggcc
tgtgtggtccatggaagtgacctgaaggacatgacctcggagcagctggatgacattttg
aagtaccacacggagattgtgtttgccaggacctctccccagcagaagcttatcattgta
gaaggctgccagagacagggtgctatcgtagctgtgacgggcgatggtgtcaatgactct
ccggccttgaagaaggcggatattggggttgccatggggattgctggctcggacgtgtct
aagcaagctgctgacatgattctcttggacgacaactttgcctcaattgtgactggagta
gaggaaggtcgtctgatcttcgataacttgaagaaatccatcgcctacaccctgaccagt
aacattccagagattacccccttcctgatatttattattgcaaacattccactgccactg
gggaccgtcaccatcctctgcattgacttgggcacggacatggttcctgccatctccctg
gcttatgagcaggctgagagtgacatcatgaagagacagcccagaaaccccaaaacggac
aagctcgtgaacgagcggctgatcagcatggcctacgggcagatcggcatgatccaggcc
ctggggggctttttcacctactttgtgattctggctgagaacggcttccttccgatcaac
ctgctgggcatccgagtggactgggacgaccgctggatcaacgatgtggaggacagctat
gggcagcagtggacctacgaacagaggaaaatcgtggagttcacctgccacaccgccttc
ttcgtgagcatcgtggtggtgcagtgggccgacctggtcatctgcaagaccaggaggaac
tccgtcttccagcagggcatgaagaacaagatcttaatatttggcctctttgaagagacg
gcccttgctgctttcctttcctactgccctggaatgggagtcgccctgaggatgtatccc
ctcaaacctacctggtggttctgtgccttcccctactccctcctcatcttcgtatatgac
gaagtcagaaagctcatcatcaggagaagccctggaggctgggtggagaaagagacctac
tactag

DBGET integrated database retrieval system