KEGG   Miniopterus natalensis: 107529071
Entry
107529071         CDS       T05883                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4 isoform X1
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107529071 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107529071 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107529071 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529071 (CHRNA4)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107529071 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1409
Other DBs
NCBI-GeneID: 107529071
NCBI-ProteinID: XP_016057841
LinkDB
Position
Unknown
AA seq 629 aa
MELGQGRAGRLPRLEPARCTMELGRPGMKPLLQLLLLLGASLLPVSGHMEARVHAEERLL
KKLFSGYNKWSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWD
PRDYENLTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVRWTPPAIYKSSC
SIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHRRVDQLDFWESGEWVIVEAVGTYNTR
KYECCAEVYPDITYAFVIRRLPLFYSVNLLAPCLLVSGLAVLVFYLPSECGEKVTLCISV
LLALTVFLLLITEIVPATSLVIPLIGEYLLFTMTFVTLSIVVTVFALNVHHRSPRTHSMP
AWVRRVFLDVAPRLLLMKRPSVVKNNCRRLLESMHKVASAPHFWPDPEGEPSFENRAQSR
GPSPTLSVCGPCQAPVRPQPPRTSPSGQEAKEASPCPSPSPCRPPTSTWAPGLTKTRSLS
VQHMSSPSKTAEGSVRCRSQSIQYCVPQDKAASRANGPTAGSLPSLRASWAELQASPHKC
KCKEPSTGSLNTAFKACNHLPLSPAVAQAVKGVQYIADHLKAEDIDFLVKEDWKYVAMVI
DRIFLWVFVIVCLLGTAGLFLPPWLAGMI
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagctggggcaaggccgagccgggagactcccgcgactagagcctgctcgctgcacc
atggagctcgggcgcccggggatgaagccgctgctgcagctgctgctgcttctgggggcc
agcctcctgcccgtgagcggccacatggaggctcgggtccatgcagaggagcgcctgctg
aagaaactcttctctggctacaacaagtggtcccggccagtggccaacatctcggacgtg
gtccttgtccactttggcctgtccattgcacagctcattgatgtggatgagaagaatcag
atgatgacaacgaatgtgtgggtgaagcaggagtggcatgactataagctgcgctgggac
cccagagactacgagaacttaacttccatcagaatcccctccgagctcatctggcggccg
gacattgtcctctacaacaatgcggatggggacttcgctgtcacccacctgaccaaggcc
cacttgttccacgacgggcgggtgcggtggacgccgcccgccatctacaagagctcctgc
agcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaagttcgggtcc
tggacgtacgacaaggccaagatcgacctggtgagcatgcaccgccgcgtggaccagctg
gacttctgggagagcggcgagtgggtcatcgtggaggccgtgggcacctacaacaccagg
aagtacgagtgctgcgcggaggtgtaccccgacatcacctacgccttcgtcatccggcgc
ctgcccctcttctacagcgtcaacctgctggccccctgcctgctcgtctccggcctggcc
gtgctggtcttctacctgccctctgagtgcggcgagaaggtcacgctgtgcatctccgtg
ctgctggcgctcaccgtcttcctgctgctcatcaccgagatcgtgcccgccacctccctg
gtcatcccgctcatcggcgagtacctgctcttcaccatgaccttcgtcaccctgtccatc
gtcgtcaccgtcttcgcgctcaacgtgcaccaccgctccccgcgcacgcactctatgccc
gcctgggtgcgccgcgtcttcctggacgttgcgccgcgtctgctcctcatgaagcggccg
tctgtggtcaagaacaactgccggcggctcctcgagtccatgcacaaggtggccagcgcc
ccacacttctggcccgaccccgagggggagcccagcttcgagaacagagcccagagccgg
ggcccctcacccaccctgtccgtctgtggtccctgccaagcgccagtcaggccccagccg
ccccgcacgtcaccctcaggccaggaggccaaggaagccagcccctgcccctcacccagc
ccctgccgcccacccaccagcacctgggccccagggctcaccaaaacccggtccctgagt
gtccagcatatgtccagccccagcaaaacagcagagggcagcgtccggtgccggtctcag
agcatccagtactgcgttccccaagacaaggctgcctcccgggccaacggccccacagct
ggctcccttccctccctgagggcttcctgggccgagctccaggcctctccccacaaatgc
aagtgcaaggagccatccactgggtccctaaatactgcgttcaaagcctgcaatcacctg
cccctgtcgcccgccgtggcgcaggctgtcaagggtgtccagtacatcgcagatcaccta
aaggcagaagacatagacttcttggtgaaggaggactggaagtacgtggccatggtcatc
gaccggatcttcctctgggtgttcgtcatcgtctgcttgctggggacagccggcctcttc
ctgccaccctggctggccggcatgatctag

KEGG   Miniopterus natalensis: 107543725
Entry
107543725         CDS       T05883                                 

Gene name
CHRNB2
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-2
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107543725 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107543725 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107543725 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543725 (CHRNB2)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107543725 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb PHO4
Other DBs
NCBI-GeneID: 107543725
NCBI-ProteinID: XP_016076801
LinkDB
Position
Unknown
AA seq 349 aa
AFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHE
REQIMTTNVWLTQEWEDYRLSWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFY
SNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVA
SLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIKRKPLFYTINLIIPCVLITSLA
ILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVSEDWKY
VAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTATFLHADHPAPSSK
NT seq 1050 nt   +upstreamnt  +downstreamnt
gccttcggcctcctccggctgtgctcaggagtctggggcacagacacagaggagcggctg
gtggagcatctcctggatccttcccgctacaacaagcttatccgcccagccaccaatggc
tctgagctggtgacggtacagctcatggtatcactggcccagctcatcagtgtgcatgag
cgggagcagatcatgaccactaatgtctggctgacccaggaatgggaagattatcgcctc
agttggaagcctgaggagttcgacaacatgaagaaagttcgactcccttccaaacacatc
tggctcccagatgtggtcctatacaacaatgctgatggcatgtacgaggtgtccttctat
tccaacgccgtggtctcctatgacggcagcatcttctggctgccccccgccatctacaag
agcgcctgcaagatcgaagtaaagcacttcccctttgaccagcagaactgtaccatgaag
ttccgctcctggacctacgaccgcaccgagatcgacctggtgctgaagagcgacgtggcc
agcctggacgacttcacgcccagcggcgagtgggacatcgtggcgctgccgggccggcgc
aacgagaaccccgacgactccacgtacgtggacatcacctacgacttcatcatcaagcgc
aagccgctcttctacaccatcaacctcatcattccctgcgtgctcatcacctcgctggcc
atcctggtcttctacctgccgtccgactgcggcgagaagatgacgctgtgcatctccgtg
ctgctggcgctcaccgtcttcctgctgctcatctccaagatcgtgccgcccacgtccctc
gacgtgccgctggtgggcaagtacctcatgttcaccatggtgagtgaagactggaagtat
gtcgccatggtgatcgaccgcctgttcctttggatctttgtctttgtctgtgtctttggc
accatcgggatgttcctacagcctctcttccagaactacaccaccgccaccttcctccat
gcagaccacccggctcccagctccaagtga

DBGET integrated database retrieval system