KEGG   Miniopterus natalensis: 107529078Help
Entry
107529078         CDS       T05883                                 

Gene name
ADCY10
Definition
(RefSeq) adenylate cyclase type 10
  KO
K11265  adenylate cyclase 10 [EC:4.6.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04024  cAMP signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107529078 (ADCY10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107529078 (ADCY10)
   04024 cAMP signaling pathway
    107529078 (ADCY10)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107529078 (ADCY10)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107529078 (ADCY10)
   04714 Thermogenesis
    107529078 (ADCY10)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107529078 (ADCY10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AAA_16 AAA_22 TPR_8 TPR_1 AAA_19
Motif
Other DBs
NCBI-GeneID: 107529078
NCBI-ProteinID: XP_016057847
LinkDB All DBs
Position
Unknown
AA seq 1609 aa AA seqDB search
MDTQKEETQDRAIVRIAAHLPDLIVYGDFCPERPSVDYFDGVLMFVDISGFTAMTEKFST
AMYMDRGAEQLVEILNHYISAIVEKVLIFGGDILKFAGDALLALWKVERKQLKNIITVVV
KCSLEIHELFGTQESDGPDIRVKIGLAAGHITMLVFGDETRNYFLVIGQTVDDVRQAQNL
AHMNDVILSPNCWQLCDRSMIEIERIPDQRAVKVNFLKLPPSFNFDEFFAKCMTFMNYYP
TGDHKNLLRLACMLESDSDLEFSLQKYVMGSISKQIDDKQLRGYLSELRPVTIVFVNLAF
KDQEKAEIIGSAIQDASVHINAVMRDFRGQINKVFMFDKGCSFLCVFGFPGEKAPDEVTH
ALESAVDIFDFCCQVQKIHTVSIGVASGTVFCGIVGHSVRHEYTVIGQKVNIAARMMMYY
PGIVTCDSVTYNGSNLPAYFFKELPKKAMKGVADSGPVYQCLGLNEKVMFGMAYLICNRS
EAYPLLGREKELKYFRCTMREFLMSNCSRVLMYEGLSGYGKSQILMEIEYLSQGENHRTI
AIALTKISFTQDFYTIQILMANVLGLDACKHYKERQTNIQNNVKTLLDEKFYSIFNDIFH
VQFPTSREVSRMSALKKQKQLEALFMKILEKTVKQERVIFIIDESQFIDSASWAFLEKLI
QTIPIFIIMSLSPFTEPPCAAASAIIKNRNTTYVTLGAVQPSDIRNKVCLDLNVKGIPKE
LDLYLVEGSCGIPFYCEELLKNLDQHRVLIFQQTESEEKANVSWNNLFKNVAKPTEQLKP
FTLGSEEGSEEVCKLSSGIRLKNLSPPASLKEISLVQLDSMSLSHQMLVRCAAIIGLTFT
TELLFEVLPCWNMKMMIKALATLVEASVFDCFRNGKELRMALKQNAASFEVNYRSLSLKP
SEGQAYREEEGLRELESEVIECHIIRFCRPMMQKTAYELWLKDQKVSMHLKCARFLEENA
HKCDRCRSGDFIPYHHFTVDIRLNSLDMDSIRQMAKSQGFKTEEEITFAKIEIPRKSDIF
SENTSSEEIKEKILSFFDIIISKMSPSQEDIIPLELCQCEEILEVVVMPLAYHFLALGEN
NKALYYFLETASAYLTLEDNYMAYTYLNEGERLLKILKQKKSVSQTFESAIFYSLKGQVC
FNMGQMVLAKKMLKKALKLLDRIFPDTFISVFFYTHVEKTRHFHYLNQQAQELSPPGKKR
LAELHQQANCFSLLWKIYSLNCFFHYKYFAHLAALMGVNTALETQDDFQIIKAYLDYSLH
HQLSGYQGMWFSYEVLAMEQIISLPLKGKGIEIMAYVADTLGYNKFLMGYLDLAIDLGCR
AQKMWALLQNPYKQYKVLCWLSRCLSLKTRHKKLIQALGWLWDLSVAEQHISSKAFFYFI
CLDIMLYSGFVYRTFNECLEFIQENEDNRILKFQSGTLLGLYSCVAIWYARLQEWDDFQI
FFSKSKSLVPRRTPTALYFQGICRYMEAQVLHLQKQIEGQPESAQDSGVELLKNLESLVT
QNSTSPVFFPRLYHLMAYVCILMGDGQNCDLFLNTALHLSETQGNMLEVCWLSLNREWWY
SNSQLSADQWVQTVLNLPTWEKIVSSKVNSQDIQKNKFLMRVNILDNPF
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atggatactcaaaaagaagaaacacaggacagggccatcgtcagaatcgcagctcaccta
ccagacctcattgtctatggagacttctgtccggagcggccttccgtggattattttgac
ggagtcttgatgtttgttgatatttcaggtttcactgcaatgactgagaagttcagcaca
gccatgtacatggaccgcggggctgagcagctggtggagatcctcaaccactacataagt
gcgatagtggagaaggtgttgatttttggaggagacatcttaaaatttgcaggtgacgct
ctcctagccctgtggaaggtggaacggaagcaactgaagaacatcatcacggtggtagtg
aaatgcagcctggagatccacgaactgttcgggacgcaggagtcggacggcccggatatc
cgagtcaagatagggctggccgccggccacatcaccatgctggtcttcggggacgaaacc
cgcaactacttcctggtgatcggccagacggtggacgacgtgcggcaggcgcagaacctg
gcgcacatgaacgatgtcatcctgtcacccaactgctggcagctctgcgaccggagcatg
attgagatcgagaggattccagaccagagagcagtgaaggttaatttcttaaaactaccc
ccttcttttaactttgatgaatttttcgcaaagtgtatgactttcatgaattattatcct
actggtgaccacaaaaacctcctgaggcttgcgtgcatgctggagtccgactccgacctg
gagttttccctacaaaagtatgtgatgggaagcatatcaaagcagattgatgacaaacag
cttcggggttacttgtctgagctccgcccagtgaccattgtgtttgtgaacctggccttt
aaggatcaagagaaagccgagatcataggctcagccatccaggacgcctctgtgcacatc
aatgctgtcatgagggacttccgaggccaaatcaataaagtcttcatgtttgacaagggc
tgctccttcctctgtgtctttggtttccccggggaaaaggcacctgatgaggtcactcat
gccttggaaagtgctgtggatatattcgacttctgctgtcaggtccagaaaatccacacc
gtctccatcggcgtggccagcgggactgtcttctgtgggatcgtcggacactctgtgaga
catgagtacacagtcattggccagaaagtgaacatagctgcccggatgatgatgtactac
cctggaatcgtgacctgcgactccgtcacctacaacggcagcaacctaccggcctacttt
ttcaaagagcttccgaagaaagccatgaaaggtgttgcagattctggaccagtctatcag
tgtttgggccttaacgagaaagtcatgtttggtatggcctacctcatctgcaacagaagt
gaggcttaccctttgctggggcgagaaaaggagctgaaatacttcaggtgcactatgagg
gaatttctgatgtccaactgcagccgagtcctcatgtatgaaggattgtcaggctacgga
aaaagccagatactcatggaaattgagtacctgtcccaaggtgagaaccacaggactatt
gctattgccttgactaagatcagcttcactcaagatttttataccatccagatactcatg
gccaacgtcttaggtctggatgcttgtaaacactacaaagaacgacagaccaacattcaa
aataacgtcaagacactgttggatgaaaaattctacagtatctttaatgacattttccat
gtccagttccctacttcacgagaggtttccaggatgagcgccttgaaaaagcaaaagcag
ttggaagcattgtttatgaagatcttggagaaaacggtgaaacaggaaagagttattttc
atcattgatgagtcccagtttatcgattcggcctcctgggcctttctggagaagcttatc
cagaccatccctatcttcatcatcatgtccctgtccccattcaccgagccgccctgtgcg
gctgccagcgccatcataaagaacaggaacaccacctacgtcaccctcggcgccgtgcag
cccagcgacatccgcaacaaggtctgcctggacctgaacgtcaagggcatccccaaagaa
ctggacttgtacctggtggagggaagctgcgggatcccattttactgcgaagaattgcta
aaaaacctcgaccagcacagggtgctcatcttccagcagacggagtctgaggaaaaggcc
aacgtgtcctggaataacctgttcaagaacgttgctaagccaacagagcagttaaaacca
ttcacgctaggcagtgaggaggggagtgaagaagtttgcaagctctctagcggcatcaga
ttgaagaacctgtcaccaccggcgtcgctgaaagaaatctctctggtccagctggacagc
atgagcctctcccaccagatgctggtgaggtgcgcggccatcatcgggctgaccttcacc
accgagctgctgttcgaggttctcccgtgctggaacatgaagatgatgattaaggccctg
gccaccctggtggaggccagcgtctttgactgcttccggaacggcaaggagctccggatg
gcgctcaagcagaacgccgcctcctttgaggtgaattaccgctccttgtctctgaagccc
agcgaaggacaggcttacagggaggaggaagggctccgggaactggagagcgaggtcatc
gagtgccacatcattcggttctgcagaccgatgatgcagaagacagcctacgagctgtgg
ctcaaggaccagaaggtgtccatgcacttgaaatgcgcccgcttcttagaggaaaatgcc
cataagtgtgaccggtgcaggagcggggacttcattccctatcaccacttcacagtggac
attcggctcaactctctagacatggactccatcaggcagatggccaaatcccagggattc
aaaactgaagaagagatcacctttgccaaaatagagattccgaggaagtctgatatattt
tcagaaaataccagttctgaagaaatcaaagaaaagatcttgagtttctttgacatcatt
atatcaaagatgagcccgtctcaggaagacatcatccctttggaattgtgccagtgcgag
gagatcctagaggtggtggtcatgcccctggcctaccattttctggctttgggagaaaac
aacaaggccttgtattacttcctagagacggcgtctgcttatctcaccttggaggacaat
tacatggcatacacgtacttgaatgagggggagaggctgctgaaaattctcaagcaaaaa
aagtctgtgagtcagacttttgagtctgccatcttctatagcctcaaaggtcaggtctgt
ttcaacatgggccagatggtacttgccaagaaaatgctgaagaaggcactgaagctcctc
gaccggattttccccgacaccttcatctctgtgtttttctatacgcatgttgagaaaacc
agacattttcattatttgaatcagcaggcccaggagctctcaccaccagggaagaagcgg
ctggcggagctccaccagcaagccaactgcttctccttgctgtggaagatctacagcttg
aactgctttttccactacaagtacttcgcccacctggcagctctgatgggcgtgaacacg
gccctggaaacgcaagatgacttccagattatcaaggcctacctggactactcactgcac
caccagctgtccggctaccagggcatgtggttcagctacgaagtcttggccatggagcag
atcatcagcctccccctgaaaggcaagggcattgagatcatggcgtatgtggccgatacc
ctgggctacaacaagttcttaatgggctacttggacttggccattgacttaggctgtcgt
gcccagaagatgtgggcactgctccagaatccctataaacaatacaaggtcctctgctgg
ctcagtaggtgtctcagcctgaaaaccaggcacaagaagctgatccaggcgctgggctgg
ctgtgggacctctccgtggccgagcagcacatcagcagcaaggcgttcttctacttcatc
tgcctggacatcatgctttattctggcttcgtgtacaggacattcaacgagtgcttggag
ttcatccaggagaacgaagacaacaggatcctcaagttccagagcgggaccctgctgggg
ctctactcatgcgtggcgatctggtatgccagactccaggagtgggacgactttcagata
tttttcagtaaatctaaaagtctagtgccaagaaggacgcccacagctctttacttccaa
ggaatctgcaggtatatggaggcccaggttcttcaccttcagaagcaaatcgaagggcag
ccggagagtgcccaggacagtggcgtcgagctactcaagaacctggagagcctggtgacg
cagaacagcaccagccctgtcttcttcccgaggctgtaccacctcatggcctacgtgtgc
atactcatgggtgacgggcagaactgcgacctcttcctgaacacagccctgcatctttcg
gagacccaggggaacatgctggaggtgtgctggctgagcctgaacagagaatggtggtac
tcaaactcccagctgagtgcggaccagtgggttcagaccgtcctgaacctcccaacatgg
gaaaaaattgtatccagcaaggtaaactcccaggacattcagaaaaacaaattccttatg
agggtgaatatcctggacaatcctttctag

DBGET integrated database retrieval system