KEGG   Miniopterus natalensis: 107529113
Entry
107529113         CDS       T05883                                 

Gene name
BMP6
Definition
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04350  TGF-beta signaling pathway
mna04390  Hippo signaling pathway
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107529113 (BMP6)
   04390 Hippo signaling pathway
    107529113 (BMP6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107529113 (BMP6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107529113 (BMP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107529113 (BMP6)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107529113 (BMP6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107529113
NCBI-ProteinID: XP_016057901
LinkDB
Position
Unknown
AA seq 295 aa
MTVMEYDQEFSPRQRHHKEFKFNLSQIPEGEAVTAAEFRIYKDCVVGSFKNQTFLISIYQ
VLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLS
INPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSATGRRRQQSRNRSTQSQDVSRVS
SASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNH
AIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaccgttatggagtacgaccaggagttctcccctcgccagcgacaccacaaagagttc
aagttcaacttgtcccagattcctgagggcgaggcggtgacggctgcagaattccgaatc
tacaaggactgtgttgtggggagttttaaaaaccaaacttttcttatcagcatttatcaa
gtcttacaggagcatcagcacagagactctgacctatttttgttggacacccgcgtagtg
tgggcctcagaagaaggctggctggaatttgacatcacggccaccagcaatctatgggtc
gtgaccccccagcacaacatggggcttcagctgagcgtggtgactcgggatggactcagc
atcaacccccgagccgcggggctggtgggcagagatggcccttatgacaagcagcctttc
atggtggccttcttcaaagtgagcgaggtccacgtgcgcaccacgaggtcagccaccggt
cggcgccggcagcagagtcgcaaccgctccacccagtcccaggacgtgtcccgggtctcc
agcgcctcagattacaacagcagtgaattaaaaacagcctgcaggaagcatgagctttat
gtgagcttccaagacctgggatggcaggactggatcatcgcacccaaggggtatgctgcc
aattactgtgatggagaatgctccttccccctcaacgcacacatgaatgccacgaaccac
gcgatcgtgcagaccctggttcaccttatgaatcctgagtatgtccccaaaccgtgctgt
gcgccaactaaactaaatgccatctcagttctttactttgatgacaactccaatgtcatc
ttgaaaaaatacagaaatatggttgtaagagcttgtggatgccactaa

DBGET integrated database retrieval system