KEGG   Miniopterus natalensis: 107529164
Entry
107529164         CDS       T05883                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05100  Bacterial invasion of epithelial cells
mna05214  Glioma
mna05220  Chronic myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107529164 (SHC3)
   04014 Ras signaling pathway
    107529164 (SHC3)
   04072 Phospholipase D signaling pathway
    107529164 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529164 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107529164 (SHC3)
   04062 Chemokine signaling pathway
    107529164 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107529164 (SHC3)
   04915 Estrogen signaling pathway
    107529164 (SHC3)
   04917 Prolactin signaling pathway
    107529164 (SHC3)
   04926 Relaxin signaling pathway
    107529164 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    107529164 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107529164 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107529164 (SHC3)
   05226 Gastric cancer
    107529164 (SHC3)
   05214 Glioma
    107529164 (SHC3)
   05220 Chronic myeloid leukemia
    107529164 (SHC3)
   05224 Breast cancer
    107529164 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    107529164 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107529164 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107529164 (SHC3)
   01522 Endocrine resistance
    107529164 (SHC3)
SSDB
Motif
Pfam: PID
Other DBs
NCBI-GeneID: 107529164
NCBI-ProteinID: XP_016057957
LinkDB
Position
Unknown
AA seq 357 aa
MRSLDFSTRTQITREAISRVCEAVPGTKGALRKRKPPNKMLSSILGKSNLQFAGMSISLT
ISTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDG
LAQDVIGSIGQAFELRFKQYLQCPSKIPVLHDRMQSLDDPWTEEEGDGSDHPYYNSIPNK
TPPPGGFVDARLKARPHAPDTAQFSGKEQTYYQGRHLGDPFGEDWQQTPVRQGPVDTYSR
PEGKGRAAPAGEAPTYVNAPRFPPQAGAAAGRSAESSPRKDLFDMKPFEDALRKRPAGPE
LSEAASVEPISPAPRIRTRDRIFDSISHLINHHLENRLPIVSAGSELCLQQPVERNP
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaggtctcttgacttcagtacaagaacacaaattaccagggaagccatcagccgcgtt
tgcgaagctgtcccaggcaccaagggagccctcaggaagagaaagcctccaaacaaaatg
ctgtccagcatcttgggcaagagtaacctccagtttgcaggaatgagcatctccctgacc
atatccactgccagcctgaacctgcggaccccggactcaaaacagatcatagcgaatcac
cacatgcagtccatctccttcgcctccgggggggacccggacacgacagactacgttgcg
tacgtagccaaggaccctgttaatcgcagagcttgccacattctggaatgctgtgacggg
ctggcacaggatgtcatcggctccattggacaagcctttgagctccgatttaagcagtat
ttgcagtgtccttccaagatccctgttctccacgaccgaatgcagagtctggatgaccca
tggactgaagaggagggagatggctcagaccatccatactacaacagcattccaaacaag
acacctcctccaggagggtttgttgatgcccgactgaaagccagaccccatgcccctgac
acagcccaattttcaggaaaagagcaaacttattaccagggaagacacctaggagaccca
tttggcgaagactggcagcaaacacctgtcaggcaagggccggtggacacgtacagcagg
ccggaggggaaggggcgcgcggcccctgccggagaggcccccacctacgtgaacgccccg
cgcttcccgccgcaggccggggctgctgcggggcgcagcgcggagagcagcccgaggaag
gacctctttgacatgaaaccctttgaagatgctctgaggaagcggccggcgggccccgag
ctgagcgaggcggcctcggtggagcccatcagccccgcgccccgaatccgaaccagggac
aggatcttcgacagcatcagccacctcatcaaccaccacctggagaacaggctgcccatc
gtctcggccgggagcgagctctgcctccagcagcccgtggagcggaacccgtga

KEGG   Miniopterus natalensis: 107535558
Entry
107535558         CDS       T05883                                 

Gene name
SHC4
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05100  Bacterial invasion of epithelial cells
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05220  Chronic myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107535558 (SHC4)
   04014 Ras signaling pathway
    107535558 (SHC4)
   04072 Phospholipase D signaling pathway
    107535558 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535558 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107535558 (SHC4)
   04062 Chemokine signaling pathway
    107535558 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107535558 (SHC4)
   04915 Estrogen signaling pathway
    107535558 (SHC4)
   04917 Prolactin signaling pathway
    107535558 (SHC4)
   04926 Relaxin signaling pathway
    107535558 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    107535558 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107535558 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107535558 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107535558 (SHC4)
   05226 Gastric cancer
    107535558 (SHC4)
   05214 Glioma
    107535558 (SHC4)
   05220 Chronic myeloid leukemia
    107535558 (SHC4)
   05224 Breast cancer
    107535558 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    107535558 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107535558 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107535558 (SHC4)
   01522 Endocrine resistance
    107535558 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 107535558
NCBI-ProteinID: XP_016066553
LinkDB
Position
Unknown
AA seq 630 aa
MRERGRDGXGGLALRLGLFGRPGMLHRAKYSRFRNESITSLDEGSPGGAAGSKGSPQPPC
PALAPHLPAEDAAAPAQEGPTPLCALIPRMASVKLANPAALLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPENSLHRPGSAPQPRRDAAGPRATGSAPEACPLPGPGGPTPRRGQDRH
FLQHLLGTGMNYYVKYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYLKNPSLSTSCESEEV
HVDGHAEDREDHEYYNEIPGKQPPVGGVSDVRVRVQVTEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAHERAVQSQSDASLLKPTCRVDLFDDPCYINTQALHSALGPARN
QSPAQPPGSPWHREKAPETVQPGATAQTASSHSLPHIQQQLRHEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHIFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRRDNIPGLLHLNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagagcgcggccgggacggcnccggggggctcgcgctgcgcctaggactcttcggc
cgccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtcc
ttggacgaaggcagtcccggcggcgccgcgggcagcaagggctcgccgcagcctccctgc
ccggccctggccccgcacctgccggcggaggatgcggccgcgccggcccaggagggcccc
accccgctgtgcgccttgatcccgcgcatggccagcgtgaagctcgccaacccagccgcc
ctgctgagtctgaaaaacttttgcttgggtaccaaagaggtaccccggctgaagcttcag
gaaagccaggacccggctcccagcagcccggcttcccccgaaaacagcctgcatagaccc
gggtctgcaccccagccccggcgggacgcggcggggccccgggcgaccggctcggctccc
gaggcctgtcccctccccggccctggggggcccaccccgaggcgcgggcaggacaggcac
tttctgcagcacctgctggggacgggcatgaactactatgtgaagtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaactcaagttacaagggaa
gcaataagtcgtctgtgtgaagctgtccctggggcaaacggagccattaaaaaacggaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttctggaatg
aacataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcacatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgccgcaacgggatggcccaagatgtcataagtaccatagggcaggcttttgagctc
cggtttaaacaatatttgaaaaatccttctttgagtacttcttgtgaaagtgaggaggtg
catgttgatggccatgctgaggacagagaagatcatgagtattacaatgagataccagga
aagcagccacctgtgggtggtgtttcagatgtgcgggtcagagttcaagtcacagaacaa
atggcttactgccccatacgctgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtctatgagaactgtttggagcaaagcagggcaatcggtaacgcccacgagaga
gccgtgcagtcccagagcgacgcctccttattgaagcccacctgccgggtggacctgttc
gacgatccctgctacatcaacacgcaggctcttcacagtgcactcggccctgcccgaaac
caaagcccagctcagccgccggggagcccgtggcaccgtgagaaagcaccagaaaccgtc
cagccaggtgccaccgcccagactgccagctcacattctttgccacacattcagcagcag
ctgcggcatgaagactgctaccatggcaagctgagcaggaaggcggcagagagcctctta
gtgaaggatggcgactttttggttcgcgagagtgcaacatctcctggccagtatgtgctg
agtgggctccagggaggccaggccaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggaccacatatttgataacgtcggccaccttatcaggtaccacatggataac
agtttgccaatcatctcttctggaagcgaagtcagccttaaacaaccggtgagaagagat
aatattccaggacttttgcatttaaacaaatga

KEGG   Miniopterus natalensis: 107538554
Entry
107538554         CDS       T05883                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05100  Bacterial invasion of epithelial cells
mna05214  Glioma
mna05220  Chronic myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107538554 (SHC2)
   04014 Ras signaling pathway
    107538554 (SHC2)
   04370 VEGF signaling pathway
    107538554 (SHC2)
   04072 Phospholipase D signaling pathway
    107538554 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107538554 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107538554 (SHC2)
   04062 Chemokine signaling pathway
    107538554 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107538554 (SHC2)
   04915 Estrogen signaling pathway
    107538554 (SHC2)
   04917 Prolactin signaling pathway
    107538554 (SHC2)
   04926 Relaxin signaling pathway
    107538554 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    107538554 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107538554 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107538554 (SHC2)
   05226 Gastric cancer
    107538554 (SHC2)
   05214 Glioma
    107538554 (SHC2)
   05220 Chronic myeloid leukemia
    107538554 (SHC2)
   05224 Breast cancer
    107538554 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    107538554 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107538554 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107538554 (SHC2)
   01522 Endocrine resistance
    107538554 (SHC2)
SSDB
Motif
Pfam: PID
Other DBs
NCBI-GeneID: 107538554
NCBI-ProteinID: XP_016070325
LinkDB
Position
Unknown
AA seq 371 aa
AAADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVT
REAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISTDGLNLSVPATR
QIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFE
LRFKQYLHSPPKVVVPPERLTGLEESAWRDEEDLEHNYYNSIPGKEPPLGGLVDSRLTLT
QPCALEALGALSQGASPPRRDTRGLHWELGPSAPPGDGYVQADAQGPRDYEDHLYVNTQG
LDAAETLQPEDSPKKDLFDMRPFEDALKLHECSVGAGAAASLPLEDQWPSPPTRRAPIAP
TDEQLRQEPCS
NT seq 1116 nt   +upstreamnt  +downstreamnt
gctgccgcagacgagtggatccgcaagggcagcttcatccacaagccggcgcacggctgg
ctgcaccccgacgccagggtcctggggcccggggtctcctacatcgttcggtacatgggg
tgcatcgaggtcttacgctccatgcgctccctggacttcaacactcgcacccaggtcacc
agggaggccatcaaccggctccatgaggctgtgcctggagttcggggctcctggaagaag
aaggcccccaacaaggctctggcctccatcctgggcaagagcaacctgcgctttgccggc
atgagcatcgccgtaagcatctctaccgatggcctcaacctctctgtgcctgccacgcgc
cagatcatcgccaatcatcacatgcagtccatttcctttgcatccggtggtgacacggac
atgacggattatgtggcctatgttgccaaggaccccatcaatcagagagcctgccacatc
ctggagtgctgcgagggcctcgcccagagcgtcatcagcactgtgggccaagccttcgag
ctgcgcttcaaacagtatctgcacagcccccccaaggtggtcgtcccccctgaaaggctg
accgggctggaggagtcggcctggagggatgaggaggacttggaacacaattactacaac
agcatcccagggaaggagccgcccctgggcgggctggtggactccaggctcaccttgaca
cagccctgtgccctcgaggccctaggagccctcagccagggagcatctcctcctcgaaga
gacacccgcggcctgcactgggagctgggcccctcagccccgcctggggatggctacgtg
caggcagatgcccaggggccccgagactacgaggaccacctgtacgtcaacacgcagggt
ctggatgccgcagagactctgcagccggaggacagccccaagaaggacctgttcgacatg
cgacccttcgaggacgccctgaagctgcacgagtgctccgtgggagcgggcgcggcagcc
tcccttcccttggaggaccagtggcccagcccccccacccgcagggcccccatcgccccc
acagacgagcagctgcggcaggagccttgctcctaa

KEGG   Miniopterus natalensis: 107543890
Entry
107543890         CDS       T05883                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05034  Alcoholism
mna05100  Bacterial invasion of epithelial cells
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05220  Chronic myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107543890 (SHC1)
   04014 Ras signaling pathway
    107543890 (SHC1)
   04072 Phospholipase D signaling pathway
    107543890 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107543890 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107543890 (SHC1)
   04062 Chemokine signaling pathway
    107543890 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107543890 (SHC1)
   04915 Estrogen signaling pathway
    107543890 (SHC1)
   04917 Prolactin signaling pathway
    107543890 (SHC1)
   04926 Relaxin signaling pathway
    107543890 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    107543890 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107543890 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107543890 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107543890 (SHC1)
   05226 Gastric cancer
    107543890 (SHC1)
   05214 Glioma
    107543890 (SHC1)
   05220 Chronic myeloid leukemia
    107543890 (SHC1)
   05224 Breast cancer
    107543890 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    107543890 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107543890 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107543890 (SHC1)
   01522 Endocrine resistance
    107543890 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 107543890
NCBI-ProteinID: XP_016077097
LinkDB
Position
Unknown
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDSPTTLCSF
FPRMSNLKLANPAGGRLGPKGEPGRLAEDGEGIIEAAMPDSGPLPLLQDMNKLSGGGGRR
TRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDF
NTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSL
NLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVI
STIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEAPDHQYYNDFPGKEPPLG
GVVDMRLREGAPPGPARPTLPSAQTSSHLGATLPVGQPVGGDPEVHKQMPPPPPCPAGRE
LFDDPSYVNIQNLDKARQAGGGAGPPNLAVNGSAPRDLFDMKPFEDALRVPPPPQSVAMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctcctgcctcccaagcccaagtacaacccactacggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccaccccaccggaggagctgccttccccatcagcctct
tccctggggcccatcctgccacctctgcctggcgatagtcccactaccctgtgctccttc
ttcccccggatgagcaacctgaagctggccaacccagctggggggcgcctggggccaaag
ggggagccaggcaggttggctgaggatggggaggggatcatagaggcagccatgccagac
tcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgcagg
actcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagctttgtc
aataagcccacgaggggctggctgcatcctaacgacaaagtcatgggacccggggtttcc
tacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccctagacttt
aacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccaggt
gctaagggggctacaagaaggagaaagccctgtagccgcccactcagttccattctgggg
aggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagcctc
aacctcatggccgcagactgcaaacagatcatcgccaatcaccacatgcagtcaatctcg
tttgcttctggcggggacccggacacagctgagtatgttgcctatgttgccaaagacccg
gtgaatcagagagcctgccatatcctggagtgtcccgaagggcttgctcaggatgtcatc
agcaccattggccaggccttcgagttacgattcaaacagtacctcaggaacccgccgaag
ctggtcaccccccatgacaggatggccggctttgatggctcagcctgggatgaggaggag
gaagaggcacctgaccatcaatactataatgacttcccggggaaggagccccctcttggg
ggggtggtggacatgaggcttcgggaaggagcccccccagggcctgctcgacccactctg
cccagtgcccagacctccagccacctgggagctacgctgcctgtggggcagcctgttggg
ggagacccagaagtccacaagcagatgccacctcctccaccctgcccagcaggcagagag
ctctttgatgacccctcctatgtgaacatccagaacctggacaaggcccggcaagcaggg
ggcggggccgggccccccaatcttgctgttaatggcagtgcaccccgagacctctttgac
atgaagccctttgaagatgcccttcgggtacctccacctccccaatcagtggccatggct
gagcagctccgaggggagccctggttccatggaaagctgagccggcgggaggctgaggcc
ctgctgcagctcaacggggatttcctggtgcgggaaagcacgaccacacctggccagtac
gtgctcactggcttgcagagtgggcagcccaagcacctactactggtggaccctgagggt
gtggttcggacaaaggatcaccggtttgagagtgttagtcacctcatcagctaccacatg
gacaaccacttgcccatcatctctgcgggcagtgaactgtgtctacaacaacctgtggag
cggaaattgtga

DBGET integrated database retrieval system