KEGG   Miniopterus natalensis: 107529260
Entry
107529260         CDS       T05883                                 

Gene name
DCTN1
Definition
(RefSeq) dynactin subunit 1 isoform X1
  KO
K04648  dynactin 1
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107529260 (DCTN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107529260 (DCTN1)
   05016 Huntington disease
    107529260 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107529260 (DCTN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107529260 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529260 (DCTN1)
   03036 Chromosome and associated proteins [BR:mna03036]
    107529260 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107529260 (DCTN1)
Membrane trafficking [BR:mna04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    107529260 (DCTN1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107529260 (DCTN1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107529260 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY Fez1
Other DBs
NCBI-GeneID: 107529260
NCBI-ProteinID: XP_016058048
LinkDB
Position
Unknown
AA seq 1257 aa
MAQSKRHVYSRTASGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKALKRE
GTDSAAKTSKLPTRPTSSTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTP
ALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQ
EWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAE
SLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRD
LSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEM
VEMLTDRNLNLEEKVRELRETVGDLEAINEMNDELQENARETELELREQLDMAGARVREA
QKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKF
AETKAHAKAIEMELRQMEVAQANRHTSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKA
ELIRKQAQEKFELSENCSERPGLRGAVGEQLSFAAGLVYSLSLLQATLHRYEHALSQCNV
DVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQP
EDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQGGQEASDIALLLRDLETSCSDIRQFCK
KIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENE
GLPVAALEELAFKASEQIYGSPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPS
KPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKK
LDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNS
QSKRTIEGLRGPPPSGIATLVSGIAGGGSPGQALGSVPGPGLVKDSPLLLQQISAMRLHI
SQLQHENSILKGAQMKASLAALPPLHVAKLSLPPREGSGNELAPGALYRKTNQLLETLNQ
LSTHIHVVDITRTNPAAKSPSAQLLEQMAQLKSLSDTVEKLKDEVLKETVSQRPGATVPT
DFATFPSSAFLRAKEEQQDDTVYLGKVTFSCAAGLGQRHRLVLTQEQLHQLHSRLIF
NT seq 3774 nt   +upstreamnt  +downstreamnt
atggcccagagcaagaggcatgtgtatagccggacagccagcggtagcagaatgagtgca
gaggccagcgcccggcctctgagagtgggctcccgcgtggaggtgattggaaaaggacac
cgaggaactgtggcctatgttggagccacactctttgccactggcaaatgggtaggcgtg
atcctggatgaagcaaagggcaagaatgatggaactgtccaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaagtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcctcaaaggccctcaaaagagag
ggaacggactcagctgcaaagacgagcaaactgcccacccgcccaaccagtagtactggg
gtggccggagccagtagctccctgggcccctctggctcagcatcagcaggtgagctgagt
agcagtgagcccagcaccccggctcagactccactggcagcacccatcatccccacgccg
gccctcacctctcctggagcagctcccccacttccttccccctccaaggaggaggagggg
ctgagggcccaggtgcgggacctggaggagaaactggagaccctgcggctgaaacgggca
gaagacaaggcaaagctgaaagagctggagaagcacaagatacagctggagcaagtgcag
gaatggaagagcaaaatgcaggagcagcaggcagacctgcagcggcgcctcaaagaggcg
cggaaggaagccaaggaggcgctggaggcaaaggaacgctacatggaggagatggctgac
actgctgatgccattgagatggccaccttggacaaggagatggctgaagagcgggctgag
tccctgcagcaggaggtggaggcactgaaggagcgtgtggatgagctcaccactgacttg
gagattctcaaggctgagattgaagagaagggctcagatggggctgcatccagttatcag
ctcaagcagcttgaggagcagaacgcccgcttgaaggatgccctggtgaggatgcgggat
ctttcttcctcagagaagcaggagcatgtgaaactccagaagctcatggaaaagaagaac
caagaactggaagttgtgaggcaacagcgggagcgcctacaggaggagctgagccaggca
gagagcaccatcgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatg
gtggaaatgctgacagaccggaacctgaatctggaagagaaagtgcgggaattgagagag
accgtgggggacttggaagcaataaatgagatgaatgatgagctgcaggagaatgcacgc
gagacggaactggagctgcgagaacagctggacatggctggcgcccgggtccgggaggcc
cagaagcgtgtggaggcagcccaggagacagttgcagactaccagcaaaccatcaagaaa
taccgccagctgaccgcccacctgcaggatgtgaatcgggaactgacaaaccagcaggaa
gcatctgtggagcggcagcagcagccacccccagagacttttgactttaaaatcaagttt
gctgagacaaaggcccatgccaaggcaattgagatggaactgaggcagatggaggtggcc
caggccaaccggcacacatccctcttgacagccttcatgcccgacagcttccttcggcca
ggtggggatcatgattgtgtcctggtgctgctgctcatgcctcgtctcatttgcaaggca
gagctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcgg
cccgggcttcggggagctgtcggggagcagctcagctttgccgctggactggtttactcg
ctgagtctgctgcaggccacactccaccgctatgaacatgccctctctcaatgcaatgtg
gatgtgtataagaaggtgggcagcctctaccctgagatgagtgcccatgaacgctccttg
gactttctcattgagctgctgcacaaggaccagctggatgagactgtcaatgtcgagcct
cttaccaaggccatcaaatactaccagcatctgtacagcatccacctcgctgaacagcct
gaggacagtaccatgcagctggccgaccatatcaagtttacccagagtgctctggactgc
atgggcgtggaggtgggacggttgcgtgccttcttgcagggtgggcaggaggcctcagat
attgccctcctgctccgggacctggaaacatcatgcagtgacatccgccagttttgcaag
aagatccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggccttt
ggaccacaggtatccgacacactccttgactgcaggaaacacttgacatgggtggtagct
gtgctgcaggaggtggcagctgctgctgcccagctcattgccccactggcggagaatgag
ggactgcctgtggctgccctggaggagttggctttcaaagcaagcgagcagatctatggg
agcccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtacc
atgaacaagttggccacagcaatgcaggagggagagtatgatgcagagcggccccccagc
aagcctccccctgttgagctgcgggctgcagcccttcgtgcagagatcacagatgccgaa
ggcctgggcttgaaacttgaagatcgagagacagttatcaaggagttgaagaagtcactc
aaaatcaagggggaggagctgagtgaagccaatgtgcggctgagcctcctggagaagaag
ctggacagtgctgccaaggatgcagacgagcgtatcgagaaagttcagactcggctggag
gagacccaggctctactgcggaagaaggagaaagagttcgaggagacgatggatgcactg
caggcggacattgaccagctggaggcagagaaggcagagctgaagcagcgcctgaacagc
cagtccaagcgcacgatcgaggggctccgggggccccctccttcgggtattgctaccctg
gtctctggcattgctggtggaggctcgcctgggcaggcactggggtctgttccaggccca
gggctggtgaaggactcaccactgctgcttcagcagatctctgccatgaggctgcacatc
tcccagcttcagcatgagaacagcatcctcaagggcgcccagatgaaggcctccttagca
gccctgccccctctgcatgtggcaaagctctccctcccaccccgtgagggctctggcaat
gagttagcccctggagcactgtatcgtaagaccaaccagctgctggagacattgaatcag
ctgagcacgcatatccatgttgtagacatcacgcgcaccaaccctgctgccaagagcccg
tcagcccaacttctggagcaaatggctcagctcaagtctctaagtgacactgtcgagaag
ctcaaggatgaggtcctcaaggagactgtgtcgcagcgccctggagccacagtccccacg
gactttgccaccttcccttcctcagccttcctcagggccaaggaggagcagcaggacgac
actgtctatctgggcaaagtgaccttctcgtgtgcggctggcctcggacagcgacatcgg
ctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatcttctaa

KEGG   Miniopterus natalensis: 107534096
Entry
107534096         CDS       T05883                                 

Gene name
DCTN6
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107534096 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107534096 (DCTN6)
   05016 Huntington disease
    107534096 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    107534096 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107534096 (DCTN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107534096 (DCTN6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107534096 (DCTN6)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107534096 (DCTN6)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107534096 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 107534096
NCBI-ProteinID: XP_016064556
LinkDB
Position
Unknown
AA seq 199 aa
MENLRESTKKARSQDTSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIG
EGNLIEEQALIINAHPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKA
YVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGVDCLRRVQTERPQPQTLQLDFLMKIL
PNYHHLKKTVKGSSTPVKN
NT seq 600 nt   +upstreamnt  +downstreamnt
atggaaaacctcagagaatctacaaaaaaagcaaggtcacaggatacaagtgtgaagatt
gctcctggagcagttgtgtgtgtagaaagtgaaatcaggggtgatgtaactataggacct
aggacagtgatccaccctaaagcacgaatcattgcggaggctggaccaatagtgattggt
gaaggtaacctaatagaagaacaggcgctgatcataaatgctcaccctgataacatcacc
ccggacactgaagatccagaacccaaacctatgatcattggcaccaataatgtatttgaa
gttggctgttattcccaagccatgaaaatgggagataataatgttattgaatcaaaagca
tacgtaggcagaaatgtcatattgacaagtggttgcatcattggggcttgttgcaaccta
aatacatttgaagtcatccctgagaatacagtgatctatggtgtagactgccttcgtcgg
gtgcagactgagcgaccacagccccagacactacagctggatttcctgatgaaaatcttg
ccaaactaccaccacttaaagaagactgtgaaaggaagctcaactccagttaagaactaa

KEGG   Miniopterus natalensis: 107537867
Entry
107537867         CDS       T05883                                 

Gene name
DCTN4
Definition
(RefSeq) dynactin subunit 4 isoform X1
  KO
K10426  dynactin 4
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107537867 (DCTN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107537867 (DCTN4)
   05016 Huntington disease
    107537867 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    107537867 (DCTN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107537867 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107537867 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107537867 (DCTN4)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107537867 (DCTN4)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107537867 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 107537867
NCBI-ProteinID: XP_016069483
LinkDB
Position
Unknown
AA seq 467 aa
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGATISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNIN
STAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEG
QVTVCFKMKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcgtctctgctgcagtcggagcgggttctctacctagtccagggagaaaagaaggtt
cgcgcccctctctcgcagctttacttctgccgctattgtagcgagctgcggtcgctggaa
tgcgtgtctcacgaggtggactcccattattgtcccagttgcttagaaaatatgccatca
gctgaagccaaactaaaaaagaacagatgcgccaactgctttgactgtcccggctgcatg
cacaccctctccacccgggccacaagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcctgtggattttgtcgctggacatctagagat
gtgggcatggcagacaaatctgtggctagtggtggttggcaggaacctgaaaatcctcac
actcaacggatgaacaagctgattgagtattaccagcagctggctcagaaagaaaaggtt
gagcgagatcgcaagaaactggcgcggcgtagaaactatatgcctttggctttttcgcaa
cacactattcatgtagtggacaaatatggccttggaaccaggcttcagcgaccacgagct
ggtgcaaccatcagtacccttgctggactttcccttaaagaaggagaggaccagaaagag
ataaagattgagccagctcaagctgtagatgaagtggaacctctacctgaagactattat
acaagaccagtcaacttaacagaggtaaccactctccagcagcgcctcttacagcctgac
ttccaaccaatctgtgcttctcagctctatcctcgccacaaacatctcctgatcaaacgg
tccctgcgctgccggaaatgtgaacataatttgagcaagccagaatttaatccaacatct
atcaaatttaaaatccagctggttgctgtcaattatataccggaagtgagaatcatgtca
attcccaaccttcgctacatgaaggagagccaggtcctcctgactcttacaaatccagtg
gagaacctcacccatgtgacactgctggagtgtgatgagggggaccctgataatatcaac
agtactgctaaggtggtggtgcctcctaaagagcttgtgttagctggcaaggatgcagca
gctgagtatgacgagttggcagaaccccaggactttcaggatgatcctgacattatagcc
ttcagaaaggccaacaaagtgggtattttcatcaaagtgaccccacaacgtgaggagggc
caagtgaccgtgtgctttaagatgaagcatgattttaaaaacctggcagcacccatccgc
cccatcgaagaaagtgaccagggcacagaagtcatctggctcactcagcatgtggaactc
agcttgggcccacttcttccttaa

KEGG   Miniopterus natalensis: 107544742
Entry
107544742         CDS       T05883                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544742 (DCTN5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107544742 (DCTN5)
   05016 Huntington disease
    107544742 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    107544742 (DCTN5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544742 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107544742 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107544742 (DCTN5)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107544742 (DCTN5)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107544742 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 107544742
NCBI-ProteinID: XP_016078141
LinkDB
Position
Unknown
AA seq 218 aa
MELGELLYNKSDSAIGARPEAWDGGLNARLRCHRAPKTHSACSLSFPALSFQASGNKVSR
QSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFP
LHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFT
VFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagctgggcgagctgctctacaacaagtccgattctgcgataggggctcggcccgag
gcgtgggatgggggcctgaatgcccgtctccgatgtcaccgggctcccaaaacccactcg
gcgtgctccctctcatttcctgctctttccttccaggcgtcggggaacaaagtcagccgc
cagtcagtgttgtgcggaagtcagaacatcgtcctcaacggcaagaccattgtgatgaat
gactgtattatccgaggggatctggcaaatgtaagagttggacgtcattgtgttgtgaaa
agccggagtgtcataaggccaccgttcaagaaattcagcaaaggcgttgcattcttccct
ttacatattggggaccatgtttttattgaggaagattgtgtggtcaacgctgctcagatt
ggctcttatgttcatgttggcaagaactgtgtgattgggcgtcgatgtgtgttgaaagac
tgctgcaaaattcttgacaacacagtattacccccagaaactgtggtcccgccattcact
gtcttctcgggctgcccaggactgttctcaggggagcttccagagtgtacccaggagctg
atgattgacgtcaccaagagctactaccagaagttcttgcccttgacacaagtctaa

KEGG   Miniopterus natalensis: 107546191
Entry
107546191         CDS       T05883                                 

Gene name
DCTN2
Definition
(RefSeq) dynactin subunit 2 isoform X1
  KO
K10424  dynactin 2
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107546191 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107546191 (DCTN2)
   05016 Huntington disease
    107546191 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    107546191 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107546191 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107546191 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107546191 (DCTN2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107546191 (DCTN2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107546191 (DCTN2)
SSDB
Motif
Pfam: Dynamitin ZapB PRD
Other DBs
NCBI-GeneID: 107546191
NCBI-ProteinID: XP_016079984
LinkDB
Position
Unknown
AA seq 405 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNSKGAGSGGKTTSGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCNQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETTQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIASSLKDNTTLLTQVQTTMRENLSTVEGNFANIDERMKKLGK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctacctgaggatgaccaagcagagttcgatgcggagctggaggaactg
acgagcacaagtgtggagcacatcattgtcaatcccaatgctgcctatgacaagttcaaa
gacaagagagtggggacaaagggacttgatttctcagatcgtattggaaaaaccaagagg
acaggatatgaatctggagaatatgagatgcttggagagggtttgggagtgaaggagaca
ccccaacaaaagtatcagagactactgcatgaggtccaagagctgacaactgaagttgag
aaaatcaagacaacagtgaaggagtcagccactgaggagaagctgacccccgtggtgctg
gctaaacagctggcagctctgaagcagcagctggttgcttcccacctggagaagctgctg
ggaccagatgcagcgatcaaccttactgaccctgatggagctctggctaagcgcctacta
ctgcagctggaagcaacaaagaacagcaaaggggctggttcagggggaaagaccacaagt
gggacccccccagatagcagccttgtcacttatgaactacattcacggcctgagcaggac
aagttctctcaagctgccaaagttgcagaacttgagaagcgcctgacagagctggaagca
actgtacgctgtaatcaggatgctcagaatcccctttctgcaggtctgcagggagcctgc
cttatggagactgtagagctgttgcaggcgaaggtgagcgccctggaccttgcagttttg
gaccaagtggaggctcggctacagagtgtcctgggaaaggtgaatgagattgccaagcat
aaagcttctgtagaggatgcagatacacaaagcaaggtgcaccagctatatgaaaccaca
cagcgctggagccccatcgcctccacccttcctgagctggtgcagagacttgtcaccatc
aagcagctgcatgagcaagccatgcagtttggtcagctcctgacacacttggacaccaca
cagcagatgattgctagttccctcaaggacaacaccaccctcttgacccaggtgcagaca
accatgcgtgaaaacctgtccacagttgaggggaattttgccaacattgatgaacggatg
aagaaactgggaaagtga

DBGET integrated database retrieval system