KEGG   Miniopterus natalensis: 107529268
Entry
107529268         CDS       T05883                                 

Gene name
ACTG2
Definition
(RefSeq) actin, gamma-enteric smooth muscle
  KO
K12315  actin, gamma-enteric smooth muscle
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107529268 (ACTG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107529268 (ACTG2)
   04147 Exosome [BR:mna04147]
    107529268 (ACTG2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107529268 (ACTG2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107529268 (ACTG2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107529268
NCBI-ProteinID: XP_016058060
LinkDB
Position
Unknown
AA seq 376 aa
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtgtgaagaggagaccaccgcccttgtgtgtgacaatggctctggcctgtgcaaggct
ggcttcgcaggagatgatgccccccgagccgttttcccttccatcgtgggtcgccctcgc
caccagggtgtaatggtgggaatgggccagaaagacagctacgtgggggacgaagctcag
agcaagcgagggatcctgaccctcaagtaccccatcgagcacggcatcatcaccaactgg
gacgacatggagaagatctggcaccactccttctacaatgagctgcgggtagcacctgag
gagcaccccaccctgctcacggaggcacccctaaatcccaaggccaacagggagaagatg
acccagatcatgtttgaaaccttcaatgtccctgccatgtatgtcgccattcaagctgtg
ctctccctctatgcttctggccgcacaacaggcatcgtcctggactcgggggacggcgtc
acccacaatgtccccatctacgagggctacgctctgcctcacgctatcatgcgcctggac
ctggcgggccgcgacctcacggactacctcatgaagatcctcacggagagaggctattcc
ttcgtgaccacagctgagcgagaaatcgtgagggacatcaaggagaagctgtgctatgtg
gccctagattttgagaatgagatggccacagccgcctcctcctcctcgctggagaagagc
tatgagctgccagacgggcaggtcatcaccatcggcaatgagcgcttccgctgccccgag
accctcttccagccctccttcattggcatggaatctgccggaattcatgaaacaacctac
aattccatcatgaagtgtgacatcgacatccgcaaggacttgtacgccaacaacgtcctc
tccgggggtaccaccatgtaccctggcattgctgacaggatgcagaaggagattacagcc
ctggcccccagtaccatgaagatcaagattattgctcccccggaacggaagtactcagtc
tggatcggaggttccatcctggcctctctctccaccttccagcagatgtggatcagcaag
ccagagtatgacgaggcagggccctccattgtccacaggaagtgcttctaa

KEGG   Miniopterus natalensis: 107543359
Entry
107543359         CDS       T05883                                 

Gene name
ACTA2
Definition
(RefSeq) actin, aortic smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107543359 (ACTA2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107543359 (ACTA2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107543359 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107543359 (ACTA2)
   04147 Exosome [BR:mna04147]
    107543359 (ACTA2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107543359 (ACTA2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107543359 (ACTA2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107543359
NCBI-ProteinID: XP_016076341
LinkDB
Position
Unknown
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcaccgccctggtgtgtgacaatggctctgggctctgtaag
gccggctttgctggggacgatgctcccagggctgttttcccatctattgtggggcgtccc
agacatcagggagtgatggtgggaatgggacaaaaagacagctacgtgggtgatgaagca
cagagcaaaagaggcatcctgaccctgaagtacccgatagaacacggtatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctacaacgaacttcgtgttgcccct
gaagagcatccaaccctgctcaccgaggcacccctgaaccccaaggccaaccgggagaaa
atgacccagattatgtttgagacgttcaatgtccctgccatgtatgtggctattcaggcg
gtgctgtccctctacgcctctggacgtacaactggcattgtgctggactctggagatggc
gtcacccacaacgtgcccatctacgagggctacgccctgccccatgccatcatgcgtctg
gacctggctggccgagacctcaccgactacctcatgaagatcctcaccgagcgtggctac
tccttcgtgaccacagcggagcgcgagatcgtccgggacatcaaggagaagctgtgctac
gtggccctggacttcgagaacgagatggccacggccgcctcctcctcctcccttgagaag
agctacgagctgcccgacgggcaagtgatcaccatcgggaacgagcgcttccgctgcccg
gagaccctcttccagccctccttcatcgggatggagtctgctggcatccatgaaaccacc
tacaacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaacgtc
ctctcggggggcaccaccatgtaccctggcattgctgaccgcatgcagaaagagatcaca
gccctggcccccagcaccatgaagatcaagatcatcgcccctccagagcgcaaatactct
gtctggatcggtggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggagtacgatgaagctgggccatccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system