KEGG   Miniopterus natalensis: 107529329
Entry
107529329         CDS       T05883                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms short isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05142  Chagas disease
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107529329 (GNAS)
   04020 Calcium signaling pathway
    107529329 (GNAS)
   04072 Phospholipase D signaling pathway
    107529329 (GNAS)
   04024 cAMP signaling pathway
    107529329 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107529329 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529329 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    107529329 (GNAS)
   04922 Glucagon signaling pathway
    107529329 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    107529329 (GNAS)
   04912 GnRH signaling pathway
    107529329 (GNAS)
   04913 Ovarian steroidogenesis
    107529329 (GNAS)
   04915 Estrogen signaling pathway
    107529329 (GNAS)
   04921 Oxytocin signaling pathway
    107529329 (GNAS)
   04926 Relaxin signaling pathway
    107529329 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    107529329 (GNAS)
   04918 Thyroid hormone synthesis
    107529329 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    107529329 (GNAS)
   04916 Melanogenesis
    107529329 (GNAS)
   04924 Renin secretion
    107529329 (GNAS)
   04925 Aldosterone synthesis and secretion
    107529329 (GNAS)
   04927 Cortisol synthesis and secretion
    107529329 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529329 (GNAS)
   04270 Vascular smooth muscle contraction
    107529329 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    107529329 (GNAS)
   04971 Gastric acid secretion
    107529329 (GNAS)
   04972 Pancreatic secretion
    107529329 (GNAS)
   04976 Bile secretion
    107529329 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107529329 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107529329 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    107529329 (GNAS)
   04728 Dopaminergic synapse
    107529329 (GNAS)
   04726 Serotonergic synapse
    107529329 (GNAS)
   04730 Long-term depression
    107529329 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107529329 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107529329 (GNAS)
   04714 Thermogenesis
    107529329 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529329 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107529329 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    107529329 (GNAS)
   05031 Amphetamine addiction
    107529329 (GNAS)
   05032 Morphine addiction
    107529329 (GNAS)
   05034 Alcoholism
    107529329 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107529329 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529329 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107529329 (GNAS)
   05165 Human papillomavirus infection
    107529329 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107529329 (GNAS)
   05142 Chagas disease
    107529329 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107529329 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529329 (GNAS)
   04031 GTP-binding proteins [BR:mna04031]
    107529329 (GNAS)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529329 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   107529329 (GNAS)
  Exosomal proteins of colorectal cancer cells
   107529329 (GNAS)
  Exosomal proteins of bladder cancer cells
   107529329 (GNAS)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    107529329 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU
Other DBs
NCBI-GeneID: 107529329
NCBI-ProteinID: XP_016058172
LinkDB
Position
Unknown
AA seq 336 aa
MRILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE
LANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYF
LDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCF
NDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLA
EKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHY
CYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggct
gccaggagcaacagcgatggtagtgagaaggccaccaaagtgcaggacatcaaaaacaac
ctgaaggaggccattgaaaccatcgtggccgccatgagcaacctggtgccgcccgtggag
ctggccaaccccgagaaccagttccgcgtggactacattctgagcgtgatgaacgtgccg
gactttgatttccctcccgaattctacgagcacgccaaggctctgtgggaggacgaggga
gtccgagcctgctacgagcgctccaacgagtaccagctgattgactgtgcccagtacttc
ctggacaagattgatgtcatcaagcaggatgactatgtccccagcgatcaggacctgctt
cgctgccgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaac
ttccacatgtttgatgtgggcggccagcgtgacgaacgccgcaaatggatccaatgcttc
aatgatgtgactgccatcatcttcgtggtagccagcagcagctacaacatggtcattcgg
gaggacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaat
aacagatggctgcgcaccatctctgtgattctgttcctcaacaagcaagacctgctcgct
gagaaagtccttgctggaaaatcgaaaattgaggactactttccagaatttgctcgctac
actactcctgaggatgcgactcccgagcccggagaggacccacgcgtgacccgggccaag
tacttcatccgcgatgagtttctgagaatcagcactgccagtggagatgggcgtcactac
tgctacccccacttcacctgcgctgtggacaccgagaacatccgccgtgtgttcaacgac
tgccgcgacatcatccagcgcatgcacctccgtcagtatgagctgctgtaa

KEGG   Miniopterus natalensis: 107529353
Entry
107529353         CDS       T05883                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04072  Phospholipase D signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04724  Glutamatergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05142  Chagas disease
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107529353
   04020 Calcium signaling pathway
    107529353
   04072 Phospholipase D signaling pathway
    107529353
   04024 cAMP signaling pathway
    107529353
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107529353
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529353
  09152 Endocrine system
   04911 Insulin secretion
    107529353
   04922 Glucagon signaling pathway
    107529353
   04923 Regulation of lipolysis in adipocytes
    107529353
   04912 GnRH signaling pathway
    107529353
   04913 Ovarian steroidogenesis
    107529353
   04915 Estrogen signaling pathway
    107529353
   04921 Oxytocin signaling pathway
    107529353
   04926 Relaxin signaling pathway
    107529353
   04935 Growth hormone synthesis, secretion and action
    107529353
   04918 Thyroid hormone synthesis
    107529353
   04928 Parathyroid hormone synthesis, secretion and action
    107529353
   04916 Melanogenesis
    107529353
   04924 Renin secretion
    107529353
   04925 Aldosterone synthesis and secretion
    107529353
   04927 Cortisol synthesis and secretion
    107529353
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529353
   04270 Vascular smooth muscle contraction
    107529353
  09154 Digestive system
   04970 Salivary secretion
    107529353
   04971 Gastric acid secretion
    107529353
   04972 Pancreatic secretion
    107529353
   04976 Bile secretion
    107529353
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107529353
   04961 Endocrine and other factor-regulated calcium reabsorption
    107529353
  09156 Nervous system
   04724 Glutamatergic synapse
    107529353
   04728 Dopaminergic synapse
    107529353
   04726 Serotonergic synapse
    107529353
   04730 Long-term depression
    107529353
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107529353
  09159 Environmental adaptation
   04713 Circadian entrainment
    107529353
   04714 Thermogenesis
    107529353
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529353
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107529353
  09165 Substance dependence
   05030 Cocaine addiction
    107529353
   05031 Amphetamine addiction
    107529353
   05032 Morphine addiction
    107529353
   05034 Alcoholism
    107529353
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107529353
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529353
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107529353
   05165 Human papillomavirus infection
    107529353
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107529353
   05142 Chagas disease
    107529353
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107529353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529353
   04031 GTP-binding proteins [BR:mna04031]
    107529353
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529353
  Exosomal proteins of other body fluids (saliva and urine)
   107529353
  Exosomal proteins of colorectal cancer cells
   107529353
  Exosomal proteins of bladder cancer cells
   107529353
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    107529353
SSDB
Motif
Pfam: NESP55 Trypan_PARP
Other DBs
NCBI-GeneID: 107529353
NCBI-ProteinID: XP_016058206
LinkDB
Position
Unknown
AA seq 242 aa
MDRRSRAHWRRARHSYNDLCPPIGRRAAAALLWLSCSIALLRALATSNARAQRAAAQQRR
SFLNAHHRSAAQVIPEPSDSDTDQEEADQDLSLPDCPEYEEEFDYESETDTESDIESDTD
FDTETETAPTTEPETEPEDERGPVVPKQSTFSQSLTERLQALRLRSPDASPSRAQSSTQE
PGSPREGEEPEPEDKDPRDPEESEEPKKEKLQQSRCKPRKPTRRDPSPESPSKRGPIPIR
RH
NT seq 729 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcactggcgccgagctcgccacagttacaacgatctgtgc
ccacccattggccgccgggcagctgccgcgctcctctggctctcctgctccatcgcgctc
ctccgcgcccttgccacctccaacgcccgcgcccagcgcgcagctgcccagcagcgccgg
agctttcttaacgcccaccaccgctccgcagcccaggtgatccccgagccctccgattct
gacaccgatcaggaggaggcagaccaagacctgtccctccccgactgcccagagtacgag
gaggagttcgactacgaatccgagaccgacaccgagtctgatattgagtccgacaccgac
ttcgacaccgagacggagaccgcccccaccactgagcccgagaccgagcccgaggacgag
cgcggccccgtggtgcccaagcagagcaccttcagccaatctctcaccgagcgtctccaa
gctctgaggctgcggagccccgacgcctccccgagtcgcgcgcagtccagcactcaggag
cccgggagccccagagagggggaggagcctgagcccgaggacaaggatccgagggacccc
gaagagtctgaggagccaaagaaggagaagctgcagcagagtcgctgcaagcccagaaag
cccacccgccgcgacccatccccggagtccccttccaaaaggggtcccatccccatccgg
cgtcactaa

DBGET integrated database retrieval system