KEGG   Miniopterus natalensis: 107529400
Entry
107529400         CDS       T05883                                 

Gene name
SLC38A3
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 3
  KO
K13576  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04724  Glutamatergic synapse
mna04727  GABAergic synapse
mna04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107529400 (SLC38A3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107529400 (SLC38A3)
   04727 GABAergic synapse
    107529400 (SLC38A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107529400 (SLC38A3)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107529400 (SLC38A3)
SSDB
Motif
Pfam: Aa_trans DUF3262
Other DBs
NCBI-GeneID: 107529400
NCBI-ProteinID: XP_016058258
LinkDB
Position
Unknown
AA seq 504 aa
MEAPLQTEMVELVPNGKHSGGLHPASTPSAGNERVEGPRRSCVEGEGFLQKSPSKEPHFT
DFDGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIVLFLFLLTAVALLSSYSIHLLLKS
SGIVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEE
KTSDWYMNGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLVAVIYKKFQVPC
PLPSNFANITSNLSLAEVMEEETLLLGKTVAPDSCTSNYFTLNIQTAYTIPIMAFAFVCH
PEVLPIYTELKDPSKRKMQHISNLSIAVMYVMYFLAALFGYLTFYDGVESELLHTYSKVD
PFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFQNQEFSWLRHAIIAIGLLTCINL
LVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIVPAEKEPAKSSPKILALCFAALGFL
MMTMSLSFIIIDWVSGTSRHGGSH
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaagcacctctgcagacggagatggtagagctggtgcccaacggcaaacactcggga
ggactccacccagccagcacccccagcgcaggcaatgagagggtcgagggcccccgacga
agctgtgttgagggcgagggtttcctacagaaaagcccgagcaaggagccacacttcacc
gactttgatgggaagacatcgttcgggatgtcggtgttcaacctcagcaatgccatcatg
ggcagcggcatcctggggctggcctacgccatggctaacacgggcatcgtcctctttctg
ttcctgttgacggccgtagccctgctctccagctactccatccacctgctgctcaagtcc
tcggggatcgtggggatccgtgcctacgagcagctgggctaccgggcctttgggaccccg
ggaaagctggcggcggctctggccatcacgctgcagaacatcggagccatgtccagctac
ctgtacatcatcaagtccgagctgccccttgtcatccagaccttcctgaacctggaggag
aaaacttcggactggtacatgaatgggaactacctggtgattctggtctctgtcaccatc
attctgcccctggcattgatgcggcagcttggctacctgggttactccagcggcttctcg
ctcagctgcatggtattcttcctagttgctgtcatctacaaaaagttccaggtgccctgc
ccactgccttccaactttgccaacatcacaagcaacctcagccttgcggaggtcatggag
gaggagacactgctcctggggaagaccgtcgccccagactcctgcacctcaaactacttc
acactcaacatacagacggcatacaccatccctatcatggccttcgccttcgtctgccac
ccggaggtgctgcccatctatacagagctcaaggacccctccaagaggaagatgcagcac
atctccaacctgtccatcgccgtcatgtatgtcatgtacttcctggccgccctgttcggc
tacctcaccttctacgacggcgtggagtcggagctgctgcacacctacagcaaggtggac
ccgttcgacgtgctgatcttgtgcgtgcgcgtggccgtgctgaccgcggtcacactcacg
gtgcccatcgttctgtttccggtgcgccgagccatccagcagatgctgttccagaaccag
gagttcagctggctgcggcacgccatcatcgccattggcctgctcacgtgcatcaacctg
ctggtcatcttcgcccccaacatcctgggcatcttcgggatcatcggtgccacgtctgcc
ccgtgcctcatcttcatctttcctgccatcttctacttccgcatcgtgcccgccgagaag
gagcccgcgaagtcctcccccaaaatcctggccctttgtttcgctgcacttggcttcttg
atgatgaccatgagcttgagcttcatcatcattgactgggtctcagggaccagccggcat
ggagggagccactag

KEGG   Miniopterus natalensis: 107541391
Entry
107541391         CDS       T05883                                 

Gene name
SLC38A5
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 5
  KO
K14992  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107541391 (SLC38A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107541391 (SLC38A5)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107541391 (SLC38A5)
SSDB
Motif
Pfam: Aa_trans Nucleos_tra2_N
Other DBs
NCBI-GeneID: 107541391
NCBI-ProteinID: XP_016073906
LinkDB
Position
Unknown
AA seq 467 aa
MELQDPKINGALPAGAVGYRQEREGFLPSHNPAPGRKPAQFMDFEGKTSFGMSVFNLSNA
IMGSGILGLAYAMAHTGVLFFLVLLLCIALLSSYSIHLLLTCAGVVGIRAYEQLGQRALG
PVGKVVVAAVICLHNVGAMSSYLFIIKSELPLVIGAFLYMDPERSWFLNGNLLIIIVSVL
IILPLALMRHLGYLGYTSGLSLTCMLFFLISVIYKKFQLDCPVGRNDTAAESKSPLGLNR
SCEAQMFTVDSQMFYSVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGAMFCMY
GLTATFGYLTFYSSVKAEMLQMYSQKDLLILCVRLAVLLAVTLTVPVVLFPIRRALQQLL
FPSKAFSWPRHVAIALILLVLVNVLVIYVPTIRDIFGVIGSTSAPSLIFILPSVFYLRIV
PSEVESLSSWPKIQALCFGVLGILFMAISLGFMFINWATGQSRVSGH
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggaactgcaggatccaaagataaatggagccctacctgcgggtgctgtgggctacagg
caggaacgagagggcttcctgcccagccataatcctgctcctgggaggaagccagcccag
ttcatggatttcgaggggaagacatcatttggaatgtcagtgttcaacctcagcaatgcc
atcatgggcagcggcatcctggggctggcctatgccatggcccacacaggggtcctcttc
ttcttggtcctgctgctgtgcattgctcttctgtcttcatactccatccatcttctgctg
acctgtgctggtgttgtaggcatccgagcctatgagcagctgggacagagggcgctgggg
cctgtggggaaggtagtggtcgctgcggtcatctgtctgcacaatgttggggccatgtcc
agttacctgttcatcatcaaatccgaactccccctggttattggtgccttcctgtacatg
gaccctgagaggagctggttcttgaatggaaacctcctcatcatcattgtcagtgtgtta
attatcctgccactggccctcatgagacacttgggctacctggggtataccagtggtctt
tctctgacctgcatgctgtttttcctcatttcggtcatctataagaagttccagcttgac
tgtcctgtgggccgcaatgatacagcagcagagagtaagagcccactggggctcaacaga
agctgtgaggctcagatgttcacagtggactcacagatgttctactcagtgcccattatg
gcttttgcctttgtctgccaccctgaggtgctgcccatctacacggagctctgccggcct
tccaagcgcagaatgcaggctgtggccaacgtgtccatcggtgccatgttctgcatgtat
gggcttacagccacctttggatacctcaccttctatagcagcgtgaaggcggagatgcta
caaatgtacagccagaaggacctgctcatcctttgtgtgcgcctggcggtgctgctcgcg
gtgactctcactgtgccagttgtgctgttccctattcgccgggccttgcagcagctgcta
ttcccaagcaaagccttcagctggccacggcatgtggccatagccctgatcctgcttgtc
ttggtcaatgttcttgtcatctatgtgccaaccatccgggatatctttggggttatcggg
tccacctcagcccccagcctcatcttcatccttcctagtgtcttctacctccgtattgta
ccctctgaggtggagtccctctcctcctggcccaagatccaggctctgtgttttggtgtc
ttggggatcctcttcatggcaatcagtctaggcttcatgtttatcaactgggccacaggc
cagagccgtgtatctggacactga

DBGET integrated database retrieval system