KEGG   Miniopterus natalensis: 107529418
Entry
107529418         CDS       T05883                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1 isoform X1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04218  Cellular senescence
mna04914  Progesterone-mediated oocyte maturation
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107529418 (CDC25A)
   04218 Cellular senescence
    107529418 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107529418 (CDC25A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107529418 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107529418 (CDC25A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107529418 (CDC25A)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107529418 (CDC25A)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107529418 (CDC25A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    107529418 (CDC25A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107529418 (CDC25A)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107529418 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 107529418
NCBI-ProteinID: XP_016058288
LinkDB
Position
Unknown
AA seq 521 aa
MELGPEPPHRRRLLFACSPPPAPPPVVKALFGAPAAGGLSPVTNLTVTMDQLQGLGSVYE
QPPEVKSSSLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRINPLPLKLLGCSPALKR
SHSDSLDHDVFQLMDQDENKENEAFEFKKPIRPASRGCLRLEEGKDLFTQRQSSAPARML
SSNERDSSEPGNFIPLFMPQSPVTASLSDEDDGFMDLLDGENLKNDEETPSCMASLWTAP
LVMRRTTNVGNRGKLFDSTSPCSPAMRSVLKRPERCQEDSPPGNTKRRKSMVWASPKEAA
SPEKPQESLHQPLSLVSSPKGTIENILDNDPRDLIGDFSKGYLFHTVSGKHQDLKYISPE
IMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTDGK
RVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQSHCEP
PSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaactgggccccgagcccccgcaccgccgccgcctgctcttcgcctgcagcccccct
cccgcgccgccgcccgtcgtgaaggcgcttttcggcgcgccagccgccgggggcctgtcg
cctgtcaccaatctgacggtcaccatggatcagctgcagggactggggagtgtatatgaa
cagccgccggaggtgaagagcagcagtctgcagagaatgggctcctcagagtcgaccgat
tcaggcttctgtctggattctcctgggcccttggatagcaaagaaaaccttgagaatccc
atgaggagaataaaccccctacctctgaagctcttggggtgtagtccagctctgaagagg
agccattccgattctcttgaccatgatgtctttcagctgatggaccaggatgagaataag
gagaatgaagcctttgagtttaagaagccaataagacctgcatctcgtggctgcctgcga
cttgaggagggtaaagatctcttcacacagaggcagagctctgccccagcccggatgctt
tcctcaaatgaaagagatagcagcgaaccagggaatttcattcctctttttatgccccag
tcacctgtgactgcctctttgtctgatgaagatgatggcttcatggaccttcttgatgga
gagaatctgaagaatgatgaagagactccgtcctgcatggcgagcctctggacggctccc
cttgtcatgagaagaactacaaacgttggcaatcgaggcaagctgtttgactccacttcc
ccatgtagcccggccatgcggtcagtgttaaaaagaccagaacgatgtcaagaggactct
ccacctggaaacacgaagcgcaggaagagcatggtctgggccagtcctaaagaggcagct
agtccagagaagccccaggagagtctacaccagcctttatccctggtatcttccccaaaa
gggaccattgagaatattctggataatgacccaagggaccttataggagacttctccaag
ggttatctctttcacactgtttccgggaagcatcaggatttaaaatacatctctccagaa
attatggcatctgttttgaatggcaagtttgctaacctcattaaagagttcgttatcatc
gactgccgatacccgtacgagtacgagggaggccacatcaagggcgcagtgaacttgcac
atggaagaagaggttgaagacttcttactcaagaagcccatcgttcctaccgacggcaag
cgcgtcatcgtggtattccactgcgagttttcttctgagcgaggccctcgcatgtgccgc
tacgtgagagagagggaccggctcggtaacgagtaccccaaactccactacccggagctg
tatgtcctgaagggcggatacaaggaattttttctgaagtgccagtctcactgtgagccc
cccagctaccggcccatgcaccatgaggactttaaagaagacctgaagaagtttcgcacc
aagagccggacctgggcaggggaaaagagcaagagggagatgtatagccgcctgaagaag
ctctga

KEGG   Miniopterus natalensis: 107530121
Entry
107530121         CDS       T05883                                 

Gene name
CDC25C
Definition
(RefSeq) M-phase inducer phosphatase 3 isoform X1
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
mna05170  Human immunodeficiency virus 1 infection
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107530121 (CDC25C)
   04114 Oocyte meiosis
    107530121 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107530121 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107530121 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107530121 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107530121 (CDC25C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107530121 (CDC25C)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107530121 (CDC25C)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107530121 (CDC25C)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107530121 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    107530121 (CDC25C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107530121 (CDC25C)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107530121 (CDC25C)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 107530121
NCBI-ProteinID: XP_016059259
LinkDB
Position
Unknown
AA seq 424 aa
MSAELISSTREEGSPGTGPSFRSHQRKILNLLLERDASFTICPDLPRTPVDKLFGDSANL
SILSGGTPKCCLDLSNLSGEISATQLTTPADADGTGPLDSSGPQEIQLAQRNHHQHLIKC
SPAQLLCSTPKTLDHGNRKKDAICSSSTNKENNNGNLVESEMKCLDSPITTVPKLDKNPK
LGKDQAEEISDELMEFSLEDEEEAKGLGLKKTVFLSDINTTQMLEEASNHGYLAGDFSKV
CALPTVSGRHQDLKYINPETVAALLLGKFQGLIEKFYIIDCRYPYEYLGGHIQGALNLYS
QEELYNFFLKMPIVPLDSQKRIIIVFHCEFSSERGPRMCRSLREEDRALNQYPALYYPEL
YILKGGYRDFFPEYMVLCEPQSYCPMHHQDHKAELLRCRSQSKAWEGERQLQEQIALLVK
DVNP
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtctgcagaactcatttcatccacaagagaggaaggaagtcctggcacaggacccagt
tttaggtcccatcagaggaagatactaaacttgctcctggagagagatgcttccttcacc
atctgtccagatctccctagaactccagtggacaaactctttggtgattctgcaaaccta
agcattttgtctggaggaaccccaaaatgttgccttgatctttcgaatcttagtggggag
atatctgccactcagcttaccactcctgcagatgctgatggaactggtcctttggattct
tcaggacctcaggaaatacagttagctcagaggaatcatcaccagcatcttataaaatgc
agcccagcacagctgctttgtagcactccgaagactttggaccatggcaacaggaagaaa
gatgcaatatgtagctcatccacaaataaagaaaataacaatggaaacttggtagaaagt
gaaatgaaatgtctggacagtcccatcactacagttccaaaattggataaaaatcccaaa
ctaggaaaagaccaggcagaggagatttcagatgaattgatggagttttccctggaagat
gaagaagaagccaagggcttaggtctaaagaagacagtctttctctctgacattaatacc
actcagatgctggaggaagcttctaaccacgggtacctggctggtgatttctccaaggta
tgtgcgctgccaaccgtgtcagggagacaccaagatctgaagtacatcaacccagaaaca
gtggctgccttactgttggggaaattccagggtctgattgagaagttttatatcatcgat
tgccgttatccatatgagtacctgggaggacacatccagggagccttaaacttgtacagt
caggaagaactatataacttctttctgaagatgcctattgtccctttggattcccagaaa
agaataatcattgtgttccactgtgaattctcctcagagaggggccctcgaatgtgccgc
tctctgagagaagaggacagggccctgaaccagtatcctgcattgtactacccagagctg
tatatcctcaaagggggctacagagacttctttccagaatatatggtgctgtgcgaaccg
cagagctattgccctatgcatcaccaggaccataaggcggagctgctgaggtgtcgaagc
cagagcaaagcatgggaaggggagcggcaactgcaggagcagattgccttactggtgaag
gatgtgaacccatga

KEGG   Miniopterus natalensis: 107536397
Entry
107536397         CDS       T05883                                 

Gene name
CDC25B
Definition
(RefSeq) M-phase inducer phosphatase 2 isoform X1
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04110  Cell cycle
mna04914  Progesterone-mediated oocyte maturation
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107536397 (CDC25B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107536397 (CDC25B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107536397 (CDC25B)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107536397 (CDC25B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107536397 (CDC25B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107536397 (CDC25B)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107536397 (CDC25B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107536397 (CDC25B)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    107536397 (CDC25B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     107536397 (CDC25B)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107536397 (CDC25B)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 107536397
NCBI-ProteinID: XP_016067556
LinkDB
Position
Unknown
AA seq 515 aa
MHDLAGLGRETPKSQVGSLLTCLSLSPRRASASSLSSESSESSDAGLCMDSPSPMDPQMA
EQTFEQAIQAASRLIRNKQFTIRRFQSLPVRLLGHSPVLRNITNAQAPGSWRKSRARGQT
AHTSGEEKENDGFIFKVPWKPTHPSHTHALAEWASRREAFAQRPSSAPDLMCLTPERKME
VEELSPLAQRFPLTPTKGTPEEDDGFVDILENDLKDDDSVPPGMESLISAPLVKTLEKEE
EQDLIMYSKCQRLFRSPSMPCGVIRPILKRLERPQDRDLPTQNKRRRSVTPLEEQQEAEE
PKARVLRSKSLCHDEIENILDSDHRELIGDYSKAFLLQTVDGKHQDLKYIAPETMVALLT
GKFSNIVERFVIVDCRYPYEYEGGHIKTAVNLPLEQDAEMFLLHSPITPCSLDKRIILIF
HCEFSSERGPRMCRFIRERDRTINDYPSLYYPEMYILKGGYKEFFPQHPTFCEPQDYRPM
NHEAFKDNLRTFRLKTRSWAGERSRRELCSRLQDK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgcacgacctcgctgggctcggcagggagaccccaaagagtcaggtaggcagcctgctc
acatgcctatccctgtccccgcggcgagcgtctgcatcctccctgtcgtctgagtcctct
gaatcttcggatgcaggtctctgcatggattctcctagccccatggacccccagatggcg
gagcagacgtttgaacaggccatccaggcagctagccggctcattcgaaacaagcagttc
accatccgacgcttccagtctttgccggtgaggctgctgggccacagccctgtgctacgg
aacatcaccaatgcccaagcacctggcagctggaggaagagcagggctcgtggccaaacc
gcccacacctctggggaggagaaagagaatgatggatttatcttcaaggtgccatggaag
cccacacatcccagccatacccatgctctggccgagtgggccagccgcagagaagccttt
gcccagaggccaagctccgcccctgacctgatgtgtctcacccctgagcggaagatggaa
gtagaggagctgagtcccctggcccaacgcttccccctgacccccaccaaggggactcct
gaggaggatgatggatttgtggacatcctggagaatgacctaaaggatgatgattcagtt
cccccaggcatggagagcctcattagtgccccactggtcaagactttggaaaaggaagaa
gagcaggacctcatcatgtacagcaaatgccagcggcttttccgctctccgtccatgccc
tgtggagtgatccggcccatccttaagaggctggagcggccccaggacagggacctgccc
acacagaacaagcgaagaaggagtgtgacccctctggaggagcagcaggaggccgaggaa
cctaaagcccgtgtcctccgctccaagtccttgtgtcatgacgagattgagaacatcctg
gacagtgaccatcgtgaactgattggggattactctaaggccttcctcctacagactgtg
gacgggaagcatcaagacctcaagtacatcgcaccagaaacgatggtggccctgctgacg
ggcaagttcagcaacatcgtggagaggtttgtgatcgtggactgcagatacccctacgag
tatgaaggcgggcacatcaagactgctgtgaacctgcccctggaacaggacgctgagatg
ttcctgctgcacagccccatcacgccctgcagcctggacaagagaatcatccttattttc
cactgtgaattctcatctgagcgtgggccccgcatgtgccgtttcatcagggaacgagat
cggaccatcaatgactaccccagcctctactatccggagatgtacattctcaaaggcggc
tacaaggagttcttcccacagcacccgaccttctgtgaaccccaggactatcgccctatg
aaccacgaggccttcaaggacaatctgaggacattccgcctcaagacgcgcagctgggcc
ggggaacggagccggagggagctctgcagccgcctgcaggacaagtga

DBGET integrated database retrieval system