KEGG   Miniopterus natalensis: 107529450
Entry
107529450         CDS       T05883                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04150  mTOR signaling pathway
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04350  TGF-beta signaling pathway
mna04360  Axon guidance
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04611  Platelet activation
mna04621  NOD-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04660  T cell receptor signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04921  Oxytocin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04972  Pancreatic secretion
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05133  Pertussis
mna05135  Yersinia infection
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107529450 (RHOA)
   04015 Rap1 signaling pathway
    107529450 (RHOA)
   04310 Wnt signaling pathway
    107529450 (RHOA)
   04350 TGF-beta signaling pathway
    107529450 (RHOA)
   04072 Phospholipase D signaling pathway
    107529450 (RHOA)
   04071 Sphingolipid signaling pathway
    107529450 (RHOA)
   04024 cAMP signaling pathway
    107529450 (RHOA)
   04022 cGMP-PKG signaling pathway
    107529450 (RHOA)
   04150 mTOR signaling pathway
    107529450 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107529450 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529450 (RHOA)
   04520 Adherens junction
    107529450 (RHOA)
   04530 Tight junction
    107529450 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107529450 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529450 (RHOA)
   04621 NOD-like receptor signaling pathway
    107529450 (RHOA)
   04625 C-type lectin receptor signaling pathway
    107529450 (RHOA)
   04660 T cell receptor signaling pathway
    107529450 (RHOA)
   04670 Leukocyte transendothelial migration
    107529450 (RHOA)
   04062 Chemokine signaling pathway
    107529450 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107529450 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    107529450 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107529450 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    107529450 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107529450 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    107529450 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529450 (RHOA)
   05206 MicroRNAs in cancer
    107529450 (RHOA)
   05205 Proteoglycans in cancer
    107529450 (RHOA)
   05203 Viral carcinogenesis
    107529450 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107529450 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107529450 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107529450 (RHOA)
   05135 Yersinia infection
    107529450 (RHOA)
   05133 Pertussis
    107529450 (RHOA)
   05152 Tuberculosis
    107529450 (RHOA)
   05100 Bacterial invasion of epithelial cells
    107529450 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107529450 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529450 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529450 (RHOA)
   04031 GTP-binding proteins [BR:mna04031]
    107529450 (RHOA)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107529450 (RHOA)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529450 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   107529450 (RHOA)
  Exosomal proteins of colorectal cancer cells
   107529450 (RHOA)
  Exosomal proteins of bladder cancer cells
   107529450 (RHOA)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107529450 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107529450
NCBI-ProteinID: XP_016058355
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaattggtgattgttggtgatggagcctgtggcaagacttgc
ttgctcattgtttttagcaaggaccagttcccggaagtgtatgtacctacagtgtttgag
aactatgtggcagatattgaagtggatgggaagcaggtagagttggctttatgggacaca
gctgggcaggaagattatgatcgcttgaggcccctctcctacccggacactgatgttata
ctgatgtgtttctccattgacagccccgatagtttagaaaacatcccggaaaaatggact
ccagaagtcaagcatttctgccccaacgtgcccatcatcctggtggggaacaagaaggat
cttcggaacgatgagcacacccggcgggagctagccaagatgaagcaggagccggtaaaa
ccagaagaaggtagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgcgggaggtttttgaaatggccacgagagcagctctgcaa
gccagacgcggaaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system