KEGG   Miniopterus natalensis: 107529564
Entry
107529564         CDS       T05883                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04611  Platelet activation
mna04720  Long-term potentiation
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04921  Oxytocin signaling pathway
mna04931  Insulin resistance
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05168  Herpes simplex virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107529564 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107529564 (PPP1CC)
   04024 cAMP signaling pathway
    107529564 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    107529564 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107529564 (PPP1CC)
   04218 Cellular senescence
    107529564 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529564 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107529564 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529564 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107529564 (PPP1CC)
   04921 Oxytocin signaling pathway
    107529564 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529564 (PPP1CC)
   04270 Vascular smooth muscle contraction
    107529564 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    107529564 (PPP1CC)
   04720 Long-term potentiation
    107529564 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107529564 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107529564 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    107529564 (PPP1CC)
   05034 Alcoholism
    107529564 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107529564 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107529564 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107529564 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107529564 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:mna03019]
    107529564 (PPP1CC)
   03041 Spliceosome [BR:mna03041]
    107529564 (PPP1CC)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107529564 (PPP1CC)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107529564 (PPP1CC)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107529564 (PPP1CC)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107529564 (PPP1CC)
Spliceosome [BR:mna03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107529564 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107529564
NCBI-ProteinID: XP_016058513
LinkDB
Position
Unknown
AA seq 341 aa
MSNGSEGVAVEQQVQPRAGKLTREPAEALLRRVLRVVRGSKPGKNVQLQENEIRGLCLKS
REIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLE
TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIA
AIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRG
VSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAM
MSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgagcaacgggtcagaaggggtcgctgtggagcagcaggtgcagccccgcgcggggaaa
ctcacgcgggagcctgcagaagcgctgctgcggcgtgtcctccgcgtggtgagggggtcc
aagcctgggaagaacgtgcagctacaggagaatgagatcagagggctgtgcctgaagtcc
cgggagatcttcctcagccagcccatcctgctggagctcgaggcgccgctcaaaatctgc
ggtgatatccatgggcaatactatgatttgcttcgactttttgagtatggtggtttcccg
ccagaaagcaactacctgtttcttggggactatgtggacagggggaagcagtcgctggag
accatctgcctcttactggcttacaaaatcaaatatccagagaatttttttcttctcaga
ggaaaccacgaatgtgccagcatcaatagaatttacggattttatgatgaatgtaaaaga
agatataacattaagctatggaaaactttcacagactgttttaactgtttgccgatagca
gccatcgtggatgagaaaatattttgctgtcatggaggtttatcaccagatcttcaatct
atggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtcttctttgt
gatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgacagagga
gtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgatttggat
cttatatgtagagcccatcaggtggttgaagatggatatgagttttttgcaaagaggcag
ttggtcactctgttttctgcacccaattattgcggagagtttgacaatgcaggtgccatg
atgagtgtggacgaaacgctaatgtgctcttttcagattttaaagcctgcagagaaaaag
aagccgaatgccacgagacccgtaacacctccaaggggtatgatcacaaagcaagcaaag
aaatag

KEGG   Miniopterus natalensis: 107533957
Entry
107533957         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04611  Platelet activation
mna04720  Long-term potentiation
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04921  Oxytocin signaling pathway
mna04931  Insulin resistance
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05168  Herpes simplex virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107533957
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107533957
   04024 cAMP signaling pathway
    107533957
   04022 cGMP-PKG signaling pathway
    107533957
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107533957
   04218 Cellular senescence
    107533957
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107533957
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533957
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107533957
  09152 Endocrine system
   04910 Insulin signaling pathway
    107533957
   04921 Oxytocin signaling pathway
    107533957
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107533957
   04270 Vascular smooth muscle contraction
    107533957
  09156 Nervous system
   04728 Dopaminergic synapse
    107533957
   04720 Long-term potentiation
    107533957
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107533957
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107533957
  09165 Substance dependence
   05031 Amphetamine addiction
    107533957
   05034 Alcoholism
    107533957
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107533957
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107533957
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107533957
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107533957
   03019 Messenger RNA biogenesis [BR:mna03019]
    107533957
   03041 Spliceosome [BR:mna03041]
    107533957
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107533957
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107533957
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107533957
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107533957
Spliceosome [BR:mna03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107533957
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107533957
NCBI-ProteinID: XP_016064351
LinkDB
Position
Unknown
AA seq 337 aa
MTDIDKLNIDSIIQQLLEVRGFKPGKNVQLQENEIRGLCLKSREIFFSQPILPELEAPLK
ICGDIHGQYYDLLXLFEYGGFPPESNYLFLGDSVDRGKQSPETICLLLAYKIKYPEKFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIMDEKIFCCHGGLSPDL
QSMEQILRIMRPTDVPDQGGLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRARQVVEDGYEFFAXRQLVTLFSAPNYCREFDSAGAMMSVDETLMCSLQILKPAE
KKKPNATRPVTPPRVASGLNSSIQKAPNYRINTVLYD
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgacggatatagataaactcaacatcgacagcatcattcaacagctgctggaagtgagg
gggttcaagcctgggaagaacgtgcagctacaggagaatgaaatcagagggctgtgcctg
aaatcccgggagatcttcttcagtcagcctatcctgccagagcttgaggcaccactcaaa
atctgtggtgatatccatgggcaatactatgatttgctttgactttttgagtatggtggt
ttcccgccagaaagcaactacctgtttcttggggactctgtggacagggggaagcagtcg
ccagagaccatctgcctcttactggcttacaaaatcaaatatcccgagaaattttttctt
ctcagaggaaaccacgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaagctgtggaaaactttcacagactgttttaactgtttgcca
atagcagccatcatggatgagaaaatattttgctgtcatggaggtttatcaccagatctt
caatctatggagcagattctgcgaattatgcgaccaactgatgtaccagatcaaggtggt
ctttgtgatctcttgtggtctgaccctgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccgtcaggtggttgaagatggatatgagttttttgcanng
aggcagttggtcactttgttttctgcacccaattactgcagagagtttgacagtgcaggt
gccatgatgagtgtggatgaaacactaatgtgctctttgcagattttaaagcctgcagag
aaaaagaagccgaatgccacgagacccgtaacacctccaagggttgcatcaggcctgaac
tcgtccattcagaaagctccaaattatagaatcaacactgttctatacgactga

KEGG   Miniopterus natalensis: 107534692
Entry
107534692         CDS       T05883                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mna  Miniopterus natalensis
Pathway
mna03015  mRNA surveillance pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04114  Oocyte meiosis
mna04218  Cellular senescence
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04611  Platelet activation
mna04720  Long-term potentiation
mna04728  Dopaminergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04921  Oxytocin signaling pathway
mna04931  Insulin resistance
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05168  Herpes simplex virus 1 infection
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107534692 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107534692 (PPP1CB)
   04024 cAMP signaling pathway
    107534692 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    107534692 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107534692 (PPP1CB)
   04218 Cellular senescence
    107534692 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107534692 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107534692 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107534692 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107534692 (PPP1CB)
   04921 Oxytocin signaling pathway
    107534692 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107534692 (PPP1CB)
   04270 Vascular smooth muscle contraction
    107534692 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    107534692 (PPP1CB)
   04720 Long-term potentiation
    107534692 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107534692 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107534692 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107534692 (PPP1CB)
   05034 Alcoholism
    107534692 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107534692 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107534692 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107534692 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107534692 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:mna03019]
    107534692 (PPP1CB)
   03041 Spliceosome [BR:mna03041]
    107534692 (PPP1CB)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107534692 (PPP1CB)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107534692 (PPP1CB)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107534692 (PPP1CB)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107534692 (PPP1CB)
Spliceosome [BR:mna03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107534692 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107534692
NCBI-ProteinID: XP_016065338
LinkDB
Position
Unknown
AA seq 299 aa
MTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLF
LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLW
KTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDP
DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSA
PNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 900 nt   +upstreamnt  +downstreamnt
atgactgaagcagaagttcggggcttatgtatcaagtctcgggagatctttctcagccag
cctattcttttggaattggaagcaccgctgaaaatttgtggagatattcatggacaatat
acagatttactgcgattatttgaatatggaggctttccaccagaagccaactatcttttc
ttaggagattatgtggacagaggaaagcagtctttggaaaccatttgtttgctattggct
tataaaatcaaatatccagagaatttctttctcttgagaggaaaccatgagtgtgctagc
atcaatcgtatttatggattctatgatgaatgcaaacgaaggtttaatattaaactgtgg
aagaccttcactgattgtttcaactgtctgcctatagctgccattgtggatgagaagatc
ttctgttgtcacggaggactgtcaccagacctgcagtctatggagcagattaggagaatt
atgagacccactgatgtccctgatacaggtttgctctgtgatttgctgtggtctgaccca
gataaggatgtgcaaggctggggagaaaatgaccgtggtgtttcctttacttttggagct
gatgtagtcagtaaatttctaaatcgtcatgatttagacttgatttgtcgagctcatcag
gtggtggaagatggatatgaattttttgctaaacgacaattggtaaccctattttcagcc
ccaaattactgtggtgaatttgataatgctggtggaatgatgagtgtggatgaaactttg
atgtgttcatttcagatattgaaaccatctgaaaagaaagctaagtaccagtatggtgga
ctgaattcaggccgtcccgtcactccacctcgaacagctaatccaccgaagaaaaggtga

DBGET integrated database retrieval system