KEGG   Miniopterus natalensis: 107529588
Entry
107529588         CDS       T05883                                 

Gene name
ORAI1
Definition
(RefSeq) calcium release-activated calcium channel protein 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04611  Platelet activation
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107529588 (ORAI1)
   04024 cAMP signaling pathway
    107529588 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529588 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    107529588 (ORAI1)
   04925 Aldosterone synthesis and secretion
    107529588 (ORAI1)
   04927 Cortisol synthesis and secretion
    107529588 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    107529588 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529588 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529588 (ORAI1)
Ion channels [BR:mna04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   107529588 (ORAI1)
SSDB
Motif
Pfam: Orai-1 m04gp34like YrhC
Other DBs
NCBI-GeneID: 107529588
NCBI-ProteinID: XP_016058538
LinkDB
Position
Unknown
AA seq 198 aa
MVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKES
PHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPAPGVVSN
VSTGGITPGQAAAIASTTIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQ
DQLDHRGDHPLTPGSHYA
NT seq 597 nt   +upstreamnt  +downstreamnt
atggtggaggtgcagctggacgctgaccatgactacccgccagggctgctcatcgccttc
agtgcctgcacgacggtgctggtagccgtgcacttgtttgcgctcatgattagcacctgc
atcctgcccaacatcgaggcggtgagcaacgtgcacaacctcaactcggtgaaggagtcg
ccccatgagcgcatgcatcgccacatcgagctggcctgggctttctccactgtcataggc
acgctgcttttcctggccgaggtcgtgctgctctgctgggtcaagttcttgcccctcaag
aagcagccgggccagccgcggcccaccagcaagcccccggcccccggcgtggtctccaac
gtcagcacgggcggcatcaccccaggccaggccgccgccatcgcctctaccaccatcatg
gtcccctttggcctggtcttcatcgtctttgctgtccacttctaccgctccctggtcagc
cataagacggaccgacagttccaggagctcaacgagctggctgagttcgcccgcttgcag
gaccagctggaccacagaggagaccaccccctgacacccggcagccactacgcctaa

DBGET integrated database retrieval system