KEGG   Miniopterus natalensis: 107529610Help
Entry
107529610         CDS       T05883                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mna  Miniopterus natalensis
Pathway
mna00010  Glycolysis / Gluconeogenesis
mna00053  Ascorbate and aldarate metabolism
mna00071  Fatty acid degradation
mna00280  Valine, leucine and isoleucine degradation
mna00310  Lysine degradation
mna00330  Arginine and proline metabolism
mna00340  Histidine metabolism
mna00380  Tryptophan metabolism
mna00410  beta-Alanine metabolism
mna00561  Glycerolipid metabolism
mna00620  Pyruvate metabolism
mna01100  Metabolic pathways
Module
mna_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107529610 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107529610 (ALDH2)
   00620 Pyruvate metabolism
    107529610 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107529610 (ALDH2)
   00561 Glycerolipid metabolism
    107529610 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107529610 (ALDH2)
   00310 Lysine degradation
    107529610 (ALDH2)
   00330 Arginine and proline metabolism
    107529610 (ALDH2)
   00340 Histidine metabolism
    107529610 (ALDH2)
   00380 Tryptophan metabolism
    107529610 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107529610 (ALDH2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107529610 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107529610
NCBI-ProteinID: XP_016058568
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MDASHRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADK
YHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHKDVDKVAFTGSTEVGRLIQVAAG
SSNLKRVTLELGGKSPNIIMSDADLDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEF
VERSVARAKSRVVGNPFDSQTEQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRG
YFIQPTVFADVQDGMTIAKEEIFGPVMQILKFKSIEEVVGRANNSMYGLAAAVFTQDLDK
ANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtcccacaggggccggctgctgtaccgcctggccgacctgattgagcgggac
cggacctacctggcagccttggagaccctggacaacggcaagccctacgtcatctcctac
ctggtggatttggacatggtcctcaaatgtctccgctactatgccggctgggctgataag
taccatgggaaaaccatccccatcgatggggacttcttcagctacacccgccacgaacct
gtgggggtgtgtgggcagatcatcccgtggaacttcccgctgttgatgcaagcgtggaaa
ctgggccccgccctggccaccggcaacgtggttgtgatgaaggtggctgagcagactcca
ctcaccgccctctacgtggccaacttgataaaggaggccggctttccccctggcgtggtc
aatatcattcccggatttggccccacggctggggctgccatcgcctcccacaaagatgtg
gacaaagtggccttcacaggctccaccgaggttggccgcctgatccaggtcgccgcgggg
agcagtaacctcaagagagtgaccctggagctgggagggaagagccccaacatcatcatg
tcagatgctgatttggactgggctgtggagcaggcgcacttcgccctgttcttcaaccag
ggccagtgctgctgtgcgggctcccggacctttgtgcaggaggatgtttacgcggagttt
gtggagcggagcgtcgcccgcgccaagtctcgggtggttgggaacccctttgacagccag
actgagcaggggccgcaggtggacgaaactcagttcaagaagatcctcggctatatcaag
tcggggaaggaagagggggcgaagctgctgtgcggcggaggggcggctgctgaccgcggc
tacttcatccagcccaccgtgtttgcagacgtgcaggacggcatgaccattgcaaaggag
gagatcttcgggccagtgatgcagatcctgaagttcaagagcatagaggaagtcgtcggg
agagctaacaattccatgtacgggctggctgccgctgtcttcacacaggacttggacaaa
gccaattatctgtcccaagcgctccaggctggcactgtgtggatcaactgctatgacgtg
tttggggcccagtctccgttcggtggctacaagatgtctgggaatggccgggagctggga
gagtatggcctgcaggcgtacactgaagtgaaaaccgtcacagtcaaggttcctcagaag
aactcataa

DBGET integrated database retrieval system