KEGG   Miniopterus natalensis: 107529684
Entry
107529684         CDS       T05883                                 

Gene name
SCARB1
Definition
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04145  Phagosome
mna04913  Ovarian steroidogenesis
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna04975  Fat digestion and absorption
mna04976  Bile secretion
mna04977  Vitamin digestion and absorption
mna04979  Cholesterol metabolism
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107529684 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107529684 (SCARB1)
   04925 Aldosterone synthesis and secretion
    107529684 (SCARB1)
   04927 Cortisol synthesis and secretion
    107529684 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    107529684 (SCARB1)
   04975 Fat digestion and absorption
    107529684 (SCARB1)
   04979 Cholesterol metabolism
    107529684 (SCARB1)
   04977 Vitamin digestion and absorption
    107529684 (SCARB1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107529684 (SCARB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107529684 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529684 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529684 (SCARB1)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    107529684 (SCARB1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529684 (SCARB1)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 107529684
NCBI-ProteinID: XP_016058666
LinkDB
Position
Unknown
AA seq 509 aa
MGRSARARWAAAALGFFGLLCAVLGAVMMVSVPSMIKQQVLKNVRIDPTSLSFSMWKEIP
VPFYLSVYFFDVVNPNEILQGRKPRVRERGPYVYREYRHKNNITFNSNDTVSFLEFRRFE
FQPDKSSGSESDYIVMPNILVLSSAVMVEQKPMGLKLLMTLAFMTFRQRAFMNRTVGEIM
WGYDDPLISVINKYFPGTFPIKGKFGLFAELNNSNSGLFTIFTGIKNFSRIHLVDKWNGL
SKVNFWHSDQCNMINGTSGQMWAPFMTPESSLEFYSPDACRSMKLIYKEAGVFEGIPTFR
FKAPETLFANGSIYPPNEGFCPCLQSGIQNISSCRFNAPLFLSHPHFYNGDPVLAEAVLG
LHPSEKEHSLFLDIHPVTGIPMNCSVKLQLSLYMKAVEGIKQTGNIEPVVLPLVWFEERG
AMEGETLQTFYTQLVLIPKVLHYSQYVLLALGAVLLLIPVIYEIRSQERCYLFWSSHKKG
SKDLESVQAYSESLMTSAPKGTVLLEARL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcaggagcgccagagcgcgctgggcggccgcggcgctgggcttcttcgggctgctg
tgcgccgtgctgggcgccgtcatgatggtgtcggtgccctccatgatcaagcagcaggtc
ctcaagaatgtgcgcattgaccccaccagcctgtccttcagcatgtggaaggagatcccc
gtccccttctacctgtctgtctacttcttcgacgtcgtcaaccccaacgaaatcctccag
ggcaggaagccgcgggtgcgggagcgcgggccctacgtgtacagggagtaccggcacaag
aacaacatcaccttcaacagcaacgacacggtgtccttcctcgagttccgcaggttcgag
ttccagccagacaagtccagcggctccgagagcgactacattgtcatgcccaacatcctg
gtcctgagtagtgctgtgatggtggagcagaagcccatgggcctgaaattgctcatgacc
ttggcattcatgaccttccgccagcgcgccttcatgaaccgcaccgtgggtgagatcatg
tggggctacgacgaccccctcataagcgtcatcaacaagtacttcccgggcacgttcccc
atcaagggcaagttcgggctgtttgctgagctcaacaattctaattccggtctcttcacc
atattcaccgggatcaaaaacttcagccggatccaccttgtggacaagtggaacgggctc
agcaaggtcaacttctggcactcagaccagtgcaacatgatcaacgggacgtccgggcag
atgtgggcgccgttcatgactcccgaatcctcgctggaattctacagccccgatgcctgc
cggtccatgaagctcatctacaaggaggcgggggtgttcgaaggcatccctactttccgg
ttcaaggcccccgaaaccttatttgccaacgggtccatctacccgcccaacgagggcttc
tgcccctgcctgcagtccggcatccagaacatcagctcgtgcaggttcaatgcacccctg
ttcctctcccaccctcacttctacaatggcgacccggtcctggcagaggcggtgctcggc
ctgcaccctagtgagaaagagcattctctgttcctggacatccacccggtcacggggatc
cccatgaactgctcggtgaagctgcagctgagcctgtacatgaaggccgtcgaaggcatc
aaacaaaccgggaacattgagcccgtggtgttgccgctggtgtggtttgaggagagaggg
gccatggagggtgagaccctgcagacgttctacacccagctggtgttgatccccaaggtt
ctgcactactcgcagtatgtcctcctggccctgggcgccgtcctgctgctcatccctgtc
atctacgagatccgcagccaagagagatgctatttattttggagtagtcataagaagggc
tccaaggatctggagtccgtacaggcctattctgaatccctgatgacttcagctcccaag
ggcactgtgctgctagaagcaaggctgtag

DBGET integrated database retrieval system