KEGG   Miniopterus natalensis: 107529760
Entry
107529760         CDS       T05883                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04151  PI3K-Akt signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  Jak-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05135  Yersinia infection
mna05142  Chagas disease (American trypanosomiasis)
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease (IBD)
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    107529760 (IL2)
   04151 PI3K-Akt signaling pathway
    107529760 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107529760 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107529760 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107529760 (IL2)
   04660 T cell receptor signaling pathway
    107529760 (IL2)
   04658 Th1 and Th2 cell differentiation
    107529760 (IL2)
   04659 Th17 cell differentiation
    107529760 (IL2)
   04672 Intestinal immune network for IgA production
    107529760 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529760 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107529760 (IL2)
   05321 Inflammatory bowel disease (IBD)
    107529760 (IL2)
   05330 Allograft rejection
    107529760 (IL2)
   05332 Graft-versus-host disease
    107529760 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107529760 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107529760 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107529760 (IL2)
   05162 Measles
    107529760 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    107529760 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107529760 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107529760 (IL2)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107529760 (IL2)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Haparin
  Cytokines
   107529760 (IL2)
SSDB
Motif
Pfam: IL2 DUF773
Other DBs
NCBI-GeneID: 107529760
NCBI-ProteinID: XP_016058740
LinkDB
Position
Unknown
AA seq 154 aa
MYKMHFLSCIALTLAFIADGAPTSSSSQETQQQLEQLMLDLNRLLNIVRNYKNPTLSMML
TFKFYMPRKTTELTHLQCLEEDLKPLEEVLNLAQSKNSHLKDIKELMSNINVLILKLKGP
ETRFTCDYNDEAVNIIEFLNKWITFCQSIFSTLI
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcacttcttgtcctgcattgcactaactcttgcattcatcgcagacggt
gcacctacctcgagctccagccaggaaacacagcagcagctggagcaattgatgctggat
ctgaatcggcttctgaacatagtcagaaattacaagaaccccacgctctccatgatgctc
acatttaaattttacatgcccaggaagaccacggaactgacacatctgcagtgtctagaa
gaagacctcaaacctctggaggaagtactaaatttagctcaaagtaaaaactctcacttg
aaagatatcaaggaattaatgagcaatatcaatgtactcattctgaaactgaagggacct
gaaacgagattcacatgtgactataatgatgaggcggtgaacatcatagaattcctgaac
aaatggattaccttttgtcaaagcatcttctcaacactgatttga

DBGET integrated database retrieval system