KEGG   Miniopterus natalensis: 107529817
Entry
107529817         CDS       T05883                                 

Gene name
ABCC3
Definition
(RefSeq) canalicular multispecific organic anion transporter 2
  KO
K05667  ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna02010  ABC transporters
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107529817 (ABCC3)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107529817 (ABCC3)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107529817 (ABCC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107529817 (ABCC3)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    107529817 (ABCC3)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 RsgA_GTPase AAA_25 RNA_helicase AAA_PrkA AAA Dynamin_N
Other DBs
NCBI-GeneID: 107529817
NCBI-ProteinID: XP_016058838
LinkDB
Position
Unknown
AA seq 1615 aa
MEEDSNLSLHTDSPDLTPCFQNSLLAWVPCIYLWAALPCYLCYLRYHHQGYIVLSHLSRL
KTAVGVLLWCVSWADLFYSFHGLVHGWAPAPIFFVTPLVVGVTMLLATLLIQYERLQGVQ
SSGVLIIFWFLCVVCAIIPFRSKILSAVAEDXSHLSRLKTAVGVLLWCVSWADLFYSFHG
LVHGWAPAPIFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFLCVVCAIIPFRS
KILSAVAEGKILDPFRFTTFYIYFALVLFALVLSCFREKPPFFSPKNVDPNPCPETDAGF
LSRLSFWWFTKLAILGYRRPLEEQDLWALNKEDCSEVVVQRLLEAWKKQQKQGARHKAEA
APGKTVSSEDEELLGGRPKPREPSFLRALLATFGPGFIISTCFMLVQDLLTFVNPRLLSI
LIRFISNPMAPTWWGFLVAGLMFTCAMMQTLILHQYYHCIFVMGLRLRTAIIGIIYKKAL
VITNSVKRESTVGEMVNLMSVDAQRVMDVAPFLNLLWSGPLQIFLAIYFLWENLGPSVLA
GVALMVLLIPVNGAVAMKMRSLQVEQMKFKDSRIKLMSEILGGIKVLKLYAWEPSFLQQV
ESIRQNELRVLRQSAYLHAISIFTWICTPFLVTLISLGVYVSVDPNNVLDAEKAFVSVSL
FNILKNPLSMLPQLISGLTQTSVSLKRIQHFLNQDELDPQCVERKTIAPGYAVTIESGTF
TWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVYVKGSVAFV
PQQAWIQNCTLQDNVLFGRALDPKRYQQTLEACALVADLEVLPGGDKTEIGEKGINLSGG
QRQRVSLARAVYSDADIYLLDDPLSAVDSHVAKHIFDQVIGPDGVLASKTRVLVTHGISF
LPQTDFVIVLADGQVSEVGTYSDLLQRNGSFANFLHNYAPDEGEEHLEDSRTAALEDAED
EEVLLIEDTLSSHTDLMDSEPVLYEVQKQFMRQLSTMSSEGEGQGRPVPRRRLGPAEKAV
QAAEAKANGMLIEEEKVGMGKVKLSVFWDYAKAVGLCTTLVICLLYAGQSAAAIGANMWL
SAWTNEAVVGHQQNTTTQRLGVYATLGILQGLLVVLSSIMMAVGCVRAARLLHQTLLHNK
MRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLSSFFTSISTLVVVVASTPLFA
VVILPLAVFYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETVTGSSVIRAYGRSQDFEA
ISDAKVDTNLRSCYPNISSNRWLGVRVEFMGNCVVFFAALFAVIGRSSLSPGVVGLSVSY
ALQVTFSLNWMIRMLSDLESNIVAVERVKEYSRTETEAPWVVEGSRPPAGWPTHGEVEFW
NYSVRYRPGLDLVLKDLSLHVRGGEKVGIVGRTGAGKSSMTLSLFRILEAAEGKIRIDGL
NVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGNYSEEDIWRALELSHLKAFVSSQP
AGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDDLIQATIRTQF
ETCTVLTIAHRLNTIMDYTRVLVLDKGTVAEFDSPTNLIAARGIFYGMARDAGLA
NT seq 4848 nt   +upstreamnt  +downstreamnt
atggaagaggactccaatctgtccctgcacacagacagcccggacctcactccctgcttc
cagaactccctgctggcctgggtcccctgcatctacctgtgggccgccctgccctgctac
ctgtgctacctgcggtaccaccaccaaggctacatcgttctttcccacctctccaggctc
aagacggccgtgggtgtcctgctgtggtgcgtttcctgggctgacctcttctactccttc
catggcctggttcacggctgggcccctgcccctatcttctttgtcacccccttggtggtg
ggggtcaccatgctgctggccaccctgctgatccagtatgagcgactgcagggggtgcag
tcctcgggggtcctcatcatcttctggtttctgtgtgtggtctgtgcaatcatccccttc
cgctccaagatcctttcagccgtggcagaggacanttcccacctctccaggctcaagacg
gccgtgggtgtcctgctgtggtgcgtttcctgggctgacctcttctactccttccatggc
ctggttcacggctgggcccctgcccctatcttctttgtcacccccttggtggtgggggtc
accatgctgctggccaccctgctgatccagtatgagcgactgcagggggtgcagtcctcg
ggggtcctcatcatcttctggtttctgtgtgtggtctgtgcaatcatccccttccgctcc
aagatcctttcagccgtggcagagggcaagatcttggaccctttccgcttcaccaccttc
tacatctacttcgccctggtgctctttgcccttgtcctgtcctgcttcagggagaagcca
cccttcttctcccccaaaaatgtcgaccctaacccctgcccagagactgacgctggtttc
ctctcccgcctgtctttctggtggttcacaaagttggccatccttggctaccggcgcccc
ctggaagagcaggacctctgggccctgaacaaggaggattgctccgaggtggtggtgcag
aggctgctggaggcctggaagaagcagcaaaagcagggagcacgacataaggccgaagca
gcacctgggaagacagtctccagtgaggatgaggagctgctggggggccggcccaagccc
cgggagccctccttcctgcgggccctgctggccacctttggccccggcttcatcatcagc
acatgcttcatgctagtccaggacctgctcaccttcgtcaacccacggctgctcagcatc
ctgatccgattcatttcaaaccccatggctcccacctggtggggcttcctggtggccggg
ctgatgttcacgtgcgccatgatgcagactctgatcttgcaccagtattaccactgcatc
ttcgtgatggggttgaggctgcgaacggcgattatagggatcatctacaagaaggctctg
gtcatcaccaattcagtcaagcgtgagtccactgtgggagaaatggtcaaccttatgtca
gtggatgcccagcgtgtcatggacgttgcccccttcctcaacctgctgtggtcgggacct
ctgcagatcttcctggccatctacttcctctgggagaacctagggccctccgttctggct
ggagtcgctcttatggtcttgctgatcccagtcaatggagctgtggccatgaagatgcgt
tctttacaggtagaacaaatgaagttcaaggactcgcgcatcaagctgatgagcgagatc
ctgggtggcatcaaggtgctgaagctgtatgcctgggagcccagcttcttgcagcaagta
gagagcatccggcagaatgagctccgggtgctgcgccagagtgcctacctccacgccata
tccatcttcacctggatctgcacccctttcctggtgaccctcatttccctcggagtgtat
gtgtctgtggacccaaacaacgtgctggacgccgagaaggcctttgtgtccgtgtccctg
ttcaatatcttaaagaaccccctcagcatgctgccccagttaatcagtggcctgacccag
accagcgtatctctgaaacggatccagcatttcctgaaccaagatgaacttgacccccag
tgtgtggaaagaaagaccatcgccccaggctatgcagtcactatagaaagcggcaccttc
acctgggcccaggacctgcccccaaccctgcacagcttagatatccaggtgccaaaaggg
gcactggtggccgtggtagggcccgtgggctgtggaaagtcctccctggtgtctgccctt
ctgggagagatggagaagctggaaggcaaggtgtatgtgaagggctccgtggcctttgtg
ccccagcaggcctggatccagaactgcactcttcaggataatgtgctctttggccgagcc
ctggaccccaagcgctaccaacaaaccctggaggcctgtgccctggtagctgacctggag
gtgctgcctggtggggacaagacagagattggagagaagggcattaacttgtctgggggc
cagcggcagcgggtcagtctggcccgagctgtttacagtgatgccgacatttatttgttg
gatgacccactctcagctgtggactcccacgtggccaagcatatctttgaccaagtcatc
gggccagatggtgtgctggcaagcaagacacgggtgctggtgacgcacggcatcagcttc
ctgccacagacagacttcgtcatagtgctagctgatgggcaggtgtctgaagtgggcact
tactcagacctcctgcagcgcaatggctcctttgccaactttctccacaactatgcacct
gatgagggcgaggagcacctggaggacagcaggaccgcagccttggaggatgcagaggat
gaagaggtgctgctgattgaagacacgctcagcagccacacagacctgatggatagtgaa
ccagtcctatatgaggtccagaagcagtttatgagacagctgagtaccatgtcctcggag
ggggagggccaaggtcggcctgtaccccggcggcgcctgggtccggcagaaaaggcagtg
caggcagcagaagcgaaggcaaatgggatgctgattgaagaggagaaggtggggatgggc
aaggtgaagctgagcgtgttctgggattatgccaaggctgtggggctctgtaccacactg
gtcatctgtctgctgtatgcgggtcaaagtgcagctgccattggggccaacatgtggctc
agtgcctggaccaacgaggctgtggtgggtcaccaacagaacaccaccacccagaggctg
ggtgtctatgccaccttgggaattctccaagggctcctggtggtgctgtcgtccatcatg
atggcagtgggctgtgttcgggctgcgcgcctgcttcaccagacgctgctgcacaacaag
atgcgctcgccacagtccttcttcgacacgacaccttcgggccgcatcctcaaccgcttc
tccaaggacatctacgtcattgacgaggtcctggcgcccaccatcctcatgctgctgagt
tccttcttcacctccatctctacgctcgtggtggtcgtggccagcacgccgctctttgcg
gtggtcatcctgcctctcgctgtcttctacatcttcgtgcagcgcttctatgtggccaca
tcacggcaactgaagaggctggaatctgtcagccgctcacccatttactcgcacttttcc
gagacggtgactggctccagcgtcatccgggcctacggccgcagccaggactttgaggcc
atcagtgatgctaaggtggacaccaacctgaggagctgctaccccaacatctcctccaac
aggtggctgggggtccgagtggagttcatgggaaactgtgttgtattctttgctgcactc
tttgctgtgattgggagaagcagcctcagtccaggggttgtgggcctttctgtgtcctat
gccttacaggtgacattttctctgaactggatgatacgaatgttatcagacttggaatca
aatattgtggctgtggagagagtcaaggagtactccaggacggagactgaggccccctgg
gtcgtggagggcagccgccctcctgcaggctggcccacccatggcgaggtggagttctgg
aattactctgtgcgctaccggccaggcctggacctggtgctgaaggacctgagtctgcac
gtgcgtggtggcgagaaggtgggaattgtgggccgcactggggctggcaaatcatccatg
accctcagcctgttccgcatcctggaggctgcagagggtaaaatccgcatcgacggcctt
aatgtggcagacatcgggctccatgacctgcgttcccagctgaccatcatcccccaggac
cccatcctgttctctgggaccctgcgtatgaacctagaccccttcggcaattactcagag
gaagacatatggcgagccttggagctgtcccacctgaaggcatttgtgagctcccagcca
gcaggcctggacttccagtgctccgagggaggagagaatctcagcgtgggtcagcggcag
ctcgtgtgcctggcccgagccctccttcgcaagagccgaatcctggttttagacgaggcc
acagccgccattgacctggagacggatgacctcatccaggctaccatccgcacccagttt
gagacctgcacggtgctcaccatcgcacaccggctcaacaccatcatggactacaccagg
gtcctggtcctggacaaagggacagtagcagaattcgattctccaaccaacctcattgca
gccagaggcatcttctacgggatggccagagatgctggacttgcctaa

DBGET integrated database retrieval system