KEGG   Miniopterus natalensis: 107529836
Entry
107529836         CDS       T05883                                 

Gene name
CACNA1G
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G isoform X1
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04713  Circadian entrainment
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107529836 (CACNA1G)
   04020 Calcium signaling pathway
    107529836 (CACNA1G)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107529836 (CACNA1G)
   04925 Aldosterone synthesis and secretion
    107529836 (CACNA1G)
   04927 Cortisol synthesis and secretion
    107529836 (CACNA1G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107529836 (CACNA1G)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107529836 (CACNA1G)
   04934 Cushing syndrome
    107529836 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107529836 (CACNA1G)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107529836 (CACNA1G)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 107529836
NCBI-ProteinID: XP_016058871
LinkDB
Position
Unknown
AA seq 2221 aa
MGSKSQEAEGTGVGCPGVGSAPALASCFLDGRFTWFERISMLVILLNCVTLGMFRPCEDI
ACDSQRCRILQAFDDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEY
SLDLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGI
VGVQLWAGLLRNRCFLPENFSLPLSVDLERYYQTENEDENPFICSQPRENGMRSCRSVPT
LRGEGGGGSPCGLDYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAI
FQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQ
LMREQRVRFLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAVGVRAGLLSS
PAPLGGQEPQPSGSCSRSHRRPSVHHLVHHHHHHHHHYHLGNGTLRGPRASPEIQDRDAN
GSRRLMLPPPSTPALSGGPPGGAEAVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVSSG
KVYPTVHTSPPPEMLKEKALVEVAPTSGPPTLTSLNIPPERYSSMHKLLETQSTGACQSS
CKISSPCLKADNGACGPDSCPYCALAGAGEVELASHEMPDSDSEAVYEFTQDAQHGDLRD
PHSRRRRNLGLDVEPNSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQ
PEELTNALEISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQG
GGLSVLRTFRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLF
GCKFASERDGDTLPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIAL
MTFGNYVLFNLLVAILVEGFQAEGDATKSESEPDFFSPSLDGDGDRKKHLAWSPHLSPAV
VSLGEHPELRRSLLPPLIIHTAATPMSLPKSSSTGLAEALGPASRRTSSSGSAEPGTAHE
MKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDE
EESSEEERASPAGSDRHHKGSLEPEAKSSFDLSDTLQVPGLHRTASGRSSASEHQGCNGK
SASGRLARALGPDDPPLDGDDGDDEGNLSKGERMRAWIRARLPACCRERDSWSAYIFPPQ
SRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYVFTAVFL
AEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISIIDILVSMVSDSGTKILGMLRVLRL
LRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQ
GEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVD
QQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRR
LEKKRRSKEKQMADLMLDDVIASGSPASAAPEAQCKPYYSDYSRFRLLVHHFCTSHYLDL
FITGVIGLNVVTMAMEHYQQPQILDEALKICNYIFTIIFVLESVFKLVAFGFRRFFQDRW
NQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDT
VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTL
FRVSTGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLE
ESNKEAKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPKPGAPHAMTHAGAA
SHYSLEHRTMVPHLEEVPVMLGPDLLTVRKSGVSRTHSLPNDSYMCRDRSTAEGSLGHRG
WGLPKAQSGSVLSVHSQPADTSYILQLPKDAPHLLQPHSTPTWGTIPKLPPPARSPLAQR
PLRRQAAIRTDSLDIQGLGSREDLLSEASGPSPPLARTSSFWGCLSSQSKISKHTHPPAP
CPSPEPTWGKSPPETRSSLELDTELSWISGDLLLVGSQEGPPSPRDLKKCYSVEAQSGQR
RPTSWLEEQRRHSIAVSCLDSGSQPHLDPDPSGLGGQPLGGPGSRPKKKLSPPSISIDPP
ESQGARPPPSPGICLRRRAPSSDSKDLLASGPPDSMAASPSPKKDVLGISGLSSDPADLD
P
NT seq 6666 nt   +upstreamnt  +downstreamnt
atggggtcgaaaagtcaagaagcagaaggcactggggtggggtgtccgggtgtgggctca
gctccagccctggccagctgtttccttgacggccgatttacgtggtttgagcgcatcagc
atgttggtcatccttctcaactgtgtgactctgggtatgttccggccatgtgaggacatt
gcctgtgactcccagcgctgccggatcctgcaggcctttgatgacttcatctttgccttc
ttcgccgtggagatggtggtgaagatggtggccttgggcatctttgggaaaaagtgttac
ctgggagacacttggaaccggctggactttttcatcgttattgcagggatgctggagtat
tcgctggacctgcagaacgtcagcttctcagctgtcaggacagtccgtgtgctgcgaccg
ctcagggccattaaccgggtgcccagcatgcgtatccttgtcacgctgctgctggacacc
ctgcccatgctgggcaacgtcctgctgctctgcttcttcgtcttcttcatcttcggtatc
gtaggagtccagctgtgggcagggctgcttcggaaccgatgcttcctgcccgagaacttc
agcctccccctgagcgtggacctggagcgctactaccagaccgagaatgaagatgagaac
cccttcatctgctcccagcctcgggagaacggcatgcgctcctgcaggagcgtgcccacc
ctgcggggggaggggggcggcggctccccctgcggcctggactacgaggcctacaacagc
tccagcaacaccacctgcgtcaactggaaccagtactacaccaactgctccgcgggggag
cacaaccccttcaagggtgccatcaacttcgacaacatcggctatgcctggatcgccatc
ttccaggtcatcacgctggagggctgggtcgacatcatgtactttgtgatggatgctcat
tccttctacaacttcatctacttcatcctgctcatcatcgtgggctccttcttcatgatc
aacctgtgcctggtggtgattgccacacagttctcagagaccaagcagcgggaaagccag
ctgatgcgggagcagcgtgtgcgcttcctgtccaacgccagtaccctggccagcttctct
gagcctggcagctgctatgaagaactgctcaagtacctggtgtacatcctccgtaaagca
gcccgcaggctggcccaggtctcccgggctgtgggcgtgcgggccggattgctgagcagc
ccggcaccccttgggggccaggagccccagcctagtggcagctgctcgcgctcccaccgc
cgcccgtctgtccatcatctggtgcatcaccaccaccatcatcatcaccactaccacctg
ggcaatgggacactgcggggcccccgggccagcccggagatccaggatagggatgccaat
gggtcccgccggctcatgctgccaccaccctcgacccctgccctctccgggggtcctccg
gggggcgcagaggctgtacacagcttctaccatgctgactgccacttggagccagtccgc
tgccaggcaccccctcccaggtcgccatctgaggcatcgggcaggactgtgagcagcggg
aaggtgtaccccactgtgcacaccagccctccaccagagatgctgaaggagaaggcactt
gtggaggttgcccccacctctggaccgcctaccctcaccagcctcaacatcccacctgag
cgctacagctccatgcacaagctgctagagacacagagtacaggcgcctgccaaagctct
tgcaagatctccagcccttgcttgaaggcagacaatggagcctgtggcccagacagctgc
ccctactgtgccctagctggggcaggggaggtggagctcgccagccacgagatgcctgac
tcagacagcgaggcggtttatgagttcacacaggacgcccagcacggcgacctccgggac
ccccacagtcgacggcgacggaacctagggctggacgtggagcccaactctgtgctggcc
ttctggaggctgatctgtgacacctttcggaagattgtggacagcaagtactttggtcgg
gggatcatgattgctatcctggtcaacacgctcagcatgggcatcgagtaccacgagcag
cccgaggagcttaccaacgccttggaaattagcaacatcgtcttcaccagcctctttgcc
ctggagatgctgctgaagctgctcgtgtacggtccctttggctacatcaagaacccctac
aacatctttgatggcgtcattgttgtcatcagtgtgtgggagatcgtgggccagcagggg
ggcggcctgtcggtgctgcggaccttccgcctgatgcgggtgctgaagctggtgcgcttc
ctgccggcgctgcagcggcagctcgtggtgctcatgaagaccatggacaacgtggccacc
ttctgcatgctgctcatgctcttcatcttcatcttcagcatcctgggcatgcatctcttc
ggctgcaaatttgcgtccgagcgggatggggacacactaccggaccggaagaattttgac
tccctgctctgggccatagtcactgtctttcagatcctgacccaggaggactggaacaag
gtgctctacaatggaatggcctccacgtcgtcctgggctgccctttacttcattgccctc
atgacctttggcaattatgtgctctttaatctgcttgttgccattctggtggagggcttc
caggcagagggagatgccaccaagtccgagtcagagcctgatttcttctcacccagcctg
gatggtgatggggacagaaagaagcacttggcctggtctccccatctctcccctgcagtg
gtgtccctgggagagcacccagagcttcggaggagcctgttgccacctctcatcatccac
acggctgccactcccatgtcgctgcccaagagctccagcactggcctggctgaggcgctg
ggccctgcctcccgccgcaccagcagcagcgggtcggctgagccagggacagcccacgag
atgaagtcaccgccaagtgcccgtagctctccacacagcccctggagtgcagcaagcagc
tggaccagcaggcgctctagccggaacagcctgggccgtgcccccagcctgaagcggagg
agcccgagtggggaacggaggtccctgttgtctggtgagggccaggagagccaggatgaa
gaggagagctcggaagaggagcgggccagcccagcaggcagtgaccgtcaccataagggt
tccctggagccggaagctaagagctcctttgatctgtcagacacactgcaggtgcccggg
ctgcaccgcacagccagtggccgcagctcagcctctgagcaccagggctgcaatggcaag
tcagcctcagggcgcctggcccgggccctgggacccgacgaccccccactggatggggac
gatggcgatgacgagggcaacctgagcaaaggggaacggatgagagcgtggatccgagct
cggctccctgcctgctgtcgggagcgagactcttggtctgcctacatcttccctcctcag
tcaaggttccgtctcctgtgtcaccggatcatcacgcacaagatgtttgaccatgtggtc
ctcgtcatcatcttcctcaactgcatcaccattgccatggagcgccccaagatcgacccg
cacagcgctgaacgcatcttcctgaccctctccaattacgtctttaccgcagtctttctg
gcggagatgaccgtgaaggtggtggctctgggctggtgcttcggggagcaggcgtacctg
cgcagcagctggaatgtgctggatgggctgctggttctcatctccatcatcgacatcctg
gtgtccatggtctccgacagcggcaccaagatcctcggcatgctgagggtgctgcggctg
ctgcggaccctgcgcccgctcagggtaatcagccgggcacagggcctgaagctggtggta
gaaacgctgatgtcctcgctgaagcccatcggcaacattgtggtcatctgttgtgccttc
ttcatcatttttggcatcctgggggtgcagctcttcaaagggaagttcttcgtgtgccag
ggtgaggacaccaggaacatcaccaacaagtctgactgtgccgaagccagttaccggtgg
gtccggcacaagtacaactttgacaacctgggccaggccctgatgtcactgttcgtgctg
gcctccaaggacggctgggtggacatcatgtacgatgggctggatgctgtgggtgtggac
cagcagcccatcatgaaccacaacccctggatgctcctgtacttcatctcgttcctgctc
attgtggccttctttgtcctgaacatgtttgtgggcgtggtggtggagaacttccacaag
tgccggcagcaccaggaggaggaggaggcccggcggcgggaggagaagcgtctgcggagg
ctggagaaaaagagaaggagtaaggagaagcagatggctgatctaatgctggacgatgta
attgcttccggcagcccagccagcgcggcgccagaagcccagtgcaaaccctactactcg
gactactcccgcttccggctccttgtccaccacttctgtaccagccactacctggatctc
ttcatcacgggtgtcattgggctgaacgtggtcaccatggccatggagcactaccagcag
cctcagatcctggatgaagctctgaagatctgcaactacatcttcaccatcatcttcgtc
ttggagtcagttttcaaactcgtggcctttggcttccgtcggttcttccaggacaggtgg
aaccagctggacctggctatcgtgctgctgtccatcatgggcatcacgctggaggagatc
gaagtcaacgcctctctgcccatcaaccccaccatcatccgcatcatgagggtgctgcgc
atcgcccgagtgctaaagctgctgaagatggctgtgggcatgcgggcgctgctggacaca
gtgatgcaggccctgccccaggtggggaacctgggacttctcttcatgttgttgtttttc
atctttgcagctctgggcgtggagctctttggagacctggagtgtgacgagacgcacccc
tgtgagggcctgggccggcatgccaccttccgaaactttggcatggcctttctgaccctc
ttccgagtctccacaggtgacaactggaatggcattatgaaggacaccctccgtgattgc
gaccaggagtctacctgctacaacacggtcatatcccccatctacttcgtgtccttcgtg
ctgacggcccagtttgtgctggtcaatgtggtgatcgccgtcctgatgaagcacctggag
gagagtaacaaggaagcgaaggaggaggccgagctggaggccgagctggagctagagatg
aagacactcagcccacagccccactcgccgctgggcagccccttcctctggcctggggtt
gagggcccggacagccccaagcccggggccccgcatgccatgacccacgctggagcagcc
tctcactactccctggagcaccgcacgatggtgccccacctggaggaggtgcccgtcatg
ctgggaccagacctgctgactgtgcggaagtctggggtcagccgcacgcactctctgccc
aatgacagctacatgtgccgggacagaagcactgccgaggggtccctgggacacaggggc
tgggggctccccaaagctcagtcaggctctgtcttgtccgttcactcccagccagcagac
accagctacatcctgcagcttcccaaagatgcaccccatctgcttcagccccacagcact
cccacctggggcaccatccccaaactgcccccaccggcccgctcccctttggctcagagg
ccccttaggcgccaggcagcaataaggaccgattccctggatatccagggcctgggcagc
agggaggacctgctgtcagaggcgagtgggccctccccgcctctggcccggacctcctcc
ttctggggctgtttgagcagccagagcaagatctcgaagcacacgcacccgccagccccc
tgcccaagcccagaacccacctggggcaaaagcccaccagagaccagaagcagcttagag
ctggacacggagctgagctggatttcaggagacctcctgctggtgggcagccaggagggg
cctccatccccgcgggacctgaagaagtgctacagcgtggaggcccagagcggccagcgc
cggcctacgtcctggctggaggaacagaggcggcactccatcgctgtcagctgcctggac
agtggctcccaaccccatctggaccctgacccctctggcctcgggggacagcctcttggg
ggacctgggagccggcccaagaaaaaactcagtcctcccagtatctctatagacccccca
gagagccagggcgctcggcccccacccagccctggcatctgcctccggcggagggctccg
tccagtgactccaaggatctcttggcctctggcccccctgacagcatggctgcctcgccc
tccccaaagaaagacgttctgggtatctccggtttatcctctgacccagcagacctggac
ccctga

KEGG   Miniopterus natalensis: 107531235
Entry
107531235         CDS       T05883                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04713  Circadian entrainment
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531235 (CACNA1I)
   04020 Calcium signaling pathway
    107531235 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107531235 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    107531235 (CACNA1I)
   04927 Cortisol synthesis and secretion
    107531235 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107531235 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531235 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531235 (CACNA1I)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107531235 (CACNA1I)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 107531235
NCBI-ProteinID: XP_016060755
LinkDB
Position
Unknown
AA seq 2013 aa
MAESSSPLSSSAVALAPEPGVTEQPGPRSPPPSPPGLEEPPEGADPDVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSERCKILQVFDDF
IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRTLGLYQTLQSQRQALGPGGPTSAKPGPHA
KEPRHFKPCPRHNPLDPAPHTLVQPISAMLASDPSSCPHCQHKVGHRPSGLGSTDSGQEG
SGSGSGGSGGGEGEAGGDGARSSEDGASSGLEKDEEEQADGAARLCGDLWRETRAKLRGI
VDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNVLEICNVVFTSMFALEMLLKLAAFGL
FDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDSGDTIPDRKNFDSLLWAIVTVFQ
ILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYS
EEDQSLSNAEEFEKLQEGLDSGGDPKLYPIPLTPNGHLDLSLPLGGHLGPTGTVAPARLS
LQPDPMLVALGSRKSSVMSLGRVSYDQRSLSSTRSSYYGPWGRSGAWASRRSSWNSLKHK
PPCAEHESLLSAERSGGSGGGARACEGAGDEGPPRAVPLHIQHAHHAHHGPHPMHRHHHH
RRTLSLDTRDSVDLAELGPAVGPHPRAAWRTVGMVPGHEDCNGRMPSIAKEVFTEMGDRQ
DDGDDEGEVDYTLCFRVRKMIDVYKPDWCEVRENWSVYLFSPENRFRVLCQTIIAHKLFD
YVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQ
AYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLK
LVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAAN
YRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATY
CPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYLFTTVFVLE
AVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIA
RVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCE
GMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSF
VLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAQGLGPGPRLPTGSPGVPG
RGPGGPGGGGDPEGRLCPHCYSPAQENLWLDSVSLIIKDSLDGELTIIDNLSGSIFHHYS
SPAGCRKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDLTACPLRPKDSKGESDP
PEPVRVGDLGECFFPLSNTAVSLGPENFLCEMEAVSFNPVRSWLKHESSQAPSSPFSPEA
SSPLLPMPAEFFHPAVSSSQKGQEKGAGAGTLPKIALQGSWASLRSPSVNCTLLRQATGS
DTSLEASRSSSAGSLQTTLEDSLTLSDSPRRAL
NT seq 6039 nt   +upstreamnt  +downstreamnt
atggctgagagctcctcgccgctctcctcttctgcagtggccctggcccctgagccagga
gtcacagagcagccggggccccggagcccccctccttcccctccaggcctggaggagccc
ccggagggagccgatccagatgtcccccacccggacctggcgcccgttgccttcttctgt
ctgcgacagaccaccagcccccggaactggtgtatcaagatggtgtgtaacccatggttc
gagtgtgtcagcatgctggtgatcttgctaaattgcgtgacacttggcatgtaccagccc
tgcgacgacatggactgcctgtcagagcgctgcaagatcctgcaggtcttcgatgatttc
atcttcatcttctttgccatggagatggtgctcaagatggtagcgctgggcatttttggc
aagaagtgctaccttggggacacatggaaccgactggattttttcattgtcatggctggg
atggtggagtactcgctggaccttcagaacatcaacctgtcggccatccgcaccgtgcgt
gtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaacctg
ctcctggacacactgcccatgctggggaacgtgctcctgctctgcttcttcgtcttcttc
atcttcggcatcatcggcgtgcagctctgggcgggtctgctgcgcaaccgctgcttcctg
gaggagaacttcaccatacaaggggatgtggccttgcccccctactaccagccagaggag
gacgacgagatgcctttcatctgctccctttcgggggacaatggcatcatgggctgccac
gagatccctccactcaaggaacagggccgcgagtgctgcctgtccaaggatgatgtctac
gacttcggggccgggcgccaggacctcaacgccagcgggctctgtgtcaactggaaccgc
tactacaacgtgtgccgcacgggcagtgccaatcctcacaaaggcgccatcaacttcgac
aacattggctatgcctggattgtcatcttccaggtgatcaccctggaaggctgggtggag
atcatgtactacgtgatggacgcgcactccttctacaacttcatctacttcatcctgctg
atcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttc
tcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctgtcg
tccagcacggtggccagctacgcggagccgggcgactgctacgaggaaatcttccagtac
gtctgccacatcctgcgcaaggccaagcgccgcacccttggcctctaccagaccctgcag
agccagcgccaggccctgggcccggggggccccacctccgccaagcccgggccccacgcc
aaggagcccaggcacttcaagccctgcccgagacacaacccactggacccagcaccccac
acactggtgcagcccatctctgccatgctggcctctgaccccagcagctgcccccactgc
cagcacaaagtgggccaccggccctcgggcctgggcagcaccgactcgggccaggaaggc
tcgggctcgggctcggggggctccggtggcggagagggtgaggccggcggggatggggcc
cgcagcagcgaagacggggcctcctcggggctggagaaagatgaggaggagcaggcggac
ggggccgcccggctgtgcggggacctgtggagggagacgcgggcaaagctgcgaggcatc
gtggacagcaagtacttcaaccggggcatcatgatggccatcctcgtcaacactgtcagc
atgggcattgagcaccacgagcagcccgaggagctgaccaacgtcctggagatctgcaac
gtggtcttcaccagcatgtttgccctggagatgctcctgaagctggccgcctttgggctc
ttcgactacctgcgcaacccctacaacatcttcgacagcatcatcgtcatcatcagcatc
tgggagattgtggggcaggctgatggcgggctgtcggtgctgcggaccttccggctgctg
cgggtgctgaagctggtgcgcttcatgcccgcactgcggcgccagctggtggtgctcatg
aagaccatggacaacgtggccaccttctgcatgctgctcatgctgttcatcttcatcttc
agcattctcgggatgcacatctttggctgcaaattcagcctccgcacagactcgggagat
acgatccccgacagaaagaacttcgactccctgctgtgggccatcgtcacggtgttccag
atcctcacccaggaggactggaacgttgtcctctacaatggcatggcctctacctccccc
tgggcctccctctactttgttgccctcatgaccttcggcaactatgtgctcttcaacctg
ctggtggccatcctggtggaaggcttccaggcggagggtgatgccaatcgctcctactcg
gaggaggaccagagtttatccaacgcggaggagtttgagaagctccaagagggcctggac
agcggtggagatcccaagctctacccaattcctctgacccccaatgggcacctggacctc
agtcttcccctgggtggacatctgggccccactgggactgtggcacctgcccgcctgtcg
ctgcagccggaccctatgctggtggccctgggctcccgcaagagcagtgtcatgtcactg
gggagggtgagctacgaccagcgctccctgtccagcacccggagctcctactatgggccg
tggggccgcagcggggcctgggccagccgccgctccagctggaacagcctcaagcacaag
ccaccgtgtgcagagcacgagtccctgctctccgcggagcgcagtggtggcagcggtggc
ggggccagggcctgcgagggcgctggggacgaagggccaccacgggctgtgcccctgcac
atccagcacgcccaccacgcacatcatggtccccacccgatgcaccggcaccaccaccac
cgccggacactgtccctcgacaccagagactcggtggacctggctgagctggggcccgcg
gtgggtccccacccccgggcggcctggaggacagtgggcatggtccccgggcacgaggac
tgcaatggcaggatgcccagcatcgccaaggaggtcttcaccgagatgggcgaccgccag
gacgacggggacgacgagggggaggtggactacactctgtgtttccgggtgcgcaagatg
attgacgtctacaagcctgactggtgcgaggtccgcgagaactggtctgtctacctcttc
tcccccgagaacaggttccgcgtcctgtgccagaccatcattgcccacaaactctttgac
tatgtcgtcctggccttcatttttctcaactgcatcaccatcgccctggagcggccccag
attgaggctggcagcaccgaacgcatattcctcaccgtgtccaactacatcttcacagcc
atcttcgtgggcgagatgacattaaaggtggtctctctgggtctgtacttcggggagcag
gcgtacctgcgcagcagctggaacgtgctggatggctttctagtcttcgtgtccatcatt
gacatcgtggtttccctggcttccgccggcggagccaagatcttgggggtcctccgggtc
ctgcggctcttgcgcaccctacgacccctgcgtgtcatcagtcgggcgcctggcctgaag
ctggtggtagagacgctcatctcctccctgaagcccattggcaacattgtcctcatctgc
tgtgccttcttcatcatcttcggcatcttgggggtgcagctcttcaagggcaagttctac
cactgtctgggtgtagacacccgaaacatcaccaaccgttctgactgcatggccgccaac
taccgctgggtccatcataagtacaacttcgacaacctgggccaggccctgatgtccctc
tttgtcttggcctccaaggatggctgggtgaacatcatgtacaatggactggatgctgtc
gctgtggaccagcagcccgtgcccaaccacaacccctggatgctgctctacttcatctcc
ttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggcgtggtggtggagaac
ttccacaagtgccggcagcaccaggaggccgaggaggcccggcggcgcgaggagaagcgg
ctgcggcgcctggagaagaagcgccgcaaggcccagcggctgccctactatgccacttac
tgtcccacccggctgctcatccactccatgtgcaccagccactacctggacatcttcatc
accttcatcatctgcctcaatgtggtcaccatgtccctggagcactacaaccagccaacg
tccctggagacagccctcaagtactgcaactacttgttcaccactgtctttgtgctggag
gctgtgctgaagctggtggcatttggtctgaggcgcttcttcaaggacaggtggaaccag
ctggacctggcgatcgtgctgctctcggtcatgggcatcacgctggaggagatcgagatc
aacgcggcactgcccatcaaccccaccatcattcgcatcatgagggttctgcgcatcgcc
cgggtgctgaagctgctgaagatggccacgggaatgcgggccctgctggacaccgtggtg
caagccctgccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctac
gccgccctgggagtggagctctttgggaagctggtctgcaacgatgagaacccgtgtgag
ggcatgagccggcatgccacctttgagaacttcggcatggccttcctcacgctcttccag
gtctccactggcgacaactggaacgggatcatgaaggacacactgagggactgcacccat
gacgagcgcagctgcctgagcagcctgcagttcgtgtcgccgctctacttcgtcagcttt
gtgctcacggcgcagtttgtgctcatcaacgtggtggtggctgtgctcatgaagcacctg
gacgacagcaacaaggaggcccaagaggacgctgagatggatgccgagctcgagctcgag
atggcccagggcctcggtcccggcccacggctgcccaccggctccccgggggtgcctggc
cgagggccaggcgggccaggcggcgggggtgacccagaaggccgcctgtgcccacactgc
tactctccagcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactcc
ttggatggggagctgaccatcatcgacaacctgtctggctccatcttccaccactattcc
tcgccggccggctgcaggaagtgccaccacgacaagcaggaggtgcagctcgctgagaca
gaagccttctccctgaactcagacaggtcctcatccatcctgctgggtgatgacctgagt
ctcgaggacctcacggcctgcccacttcgccctaaagacagcaagggtgagtcagaccca
cctgagcccgtgcgtgtgggggatctgggtgagtgcttcttccccttgtccaacacagcc
gtatccttggggcctgagaacttcctgtgcgagatggaggcagtctccttcaaccccgtc
cgatcctggctgaaacatgagagcagccaagcaccttcgagccccttctccccagaggca
tccagcccactcctgcccatgccagcggagttcttccaccctgctgtgtcctccagccag
aaagggcaggagaagggtgctggtgctgggaccctccccaagattgccctgcagggctcc
tgggcatccctgcggtcaccgagtgtcaactgcaccctcctccggcaggccacagggagc
gacacttcgctggaggccagccgcagcagctcagcgggcagcctgcagaccacactggag
gacagcctgaccctgagtgacagtccccggcgcgccctg

KEGG   Miniopterus natalensis: 107533412
Entry
107533412         CDS       T05883                                 

Gene name
CACNA1H
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04713  Circadian entrainment
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107533412 (CACNA1H)
   04020 Calcium signaling pathway
    107533412 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107533412 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    107533412 (CACNA1H)
   04927 Cortisol synthesis and secretion
    107533412 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533412 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107533412 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107533412 (CACNA1H)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107533412 (CACNA1H)
SSDB
Motif
Pfam: Ion_trans PKD_channel Mlo TMEM208_SND2
Other DBs
NCBI-GeneID: 107533412
NCBI-ProteinID: XP_016063581
LinkDB
Position
Unknown
AA seq 2229 aa
MLVIMLNCVTLGMFRPCEDVKCRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCY
LGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDT
LPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGDE
NPFICSSRRDNGMQKCSHIPSRRELRVECTLGWEAYGQPQAEGMGGIGHNACINWNQYYN
ICRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIV
GSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSDDSTLASFSEPGSCYEELLKYVG
HICRKVKRRSLRLYARWQSRWCKKVDPNSALHGQGPGHQPRRAGRRAASIHHLVYHHHHH
HHHHYHFSHGSPRRPGPEQGTRDASLVQARALPSPPSPGPGPLDAESVHSVYHADCHVEG
PQERAQVVQAAATNNNLKLAMGLGAMNYPTILPSATGGGKGGTSPGPRGKRASRTPGAGG
HSSLSLSSHDPYEKIQHLVGEHGLGRAPSRLSGLSVPCPLPSPQAGTLTCELKDCPYCAS
ALGDPEFEFSDSESGDSDGNMVYEFTQDVRHGDHRDPMQPTPGGDTPAQGGVRRRAQQRM
ASGKHGGLGRVWAAVSGKLRRIVDSKYFNRGIMMAILTNTLSMGVEYHEQPDELTNALEI
SNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIIGQADGGLSVLRTFR
LLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDT
GDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLF
NLLVAILVEGFQAEGDANRSDTDEDKTSTHLEEDFDKFRDLRAAEMKMYSLAVTPNGHLE
GQGSLPPPVIMRTAATPMPTPKSSPNLDAAHSLLDSRRGSSSSMDPQLGDQKSLSSLRSS
PCTHWGPNSAWSSRRSSWNSLGRAPSLKRRSQCGERESLLSGEGKGSTDEEAEDGRPKVG
ASPCTHATPLRRTESLDHRGTLDVQPLRPATLLPTKLHDCNGQMLALPSEFFLRIDSHKE
DPAEFDDDMEDSCCSRLRKVLEPYKPEWCRNREPWSLYLFSPQNRFRASCQKVIAHKMFD
HVVLVFIFLNCITIALERPDIDPGSTERIFLSVSNYIFTAIFVAEMMVKVVALGLVSGEH
AYLQSSWNVLDGLLVLVSLVDIIVAMASAGGAKILGILRVLRLLRTLRPLRVISRAPGLK
LVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNISTRAECQAAH
YRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVPNHNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRQRRLERKRRSTLPNPEAQRR
PYYADYSPTRRSIHSLCTSHYLDLFITFIIGVNVITMSMEHYNQPKSLDEALKYCNYVFT
IVFVFEAVLKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEMSAALPINPTIIRIM
RVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECS
EDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECAREDKHCLTYLPAISP
IYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAELELEMAQELPAHPRPTAP
QSPSTGPEAPNLPVARKVSVSRMLSLPNDSYMFRPVAPASAPHRHPLQEVEMDTYVGTTS
SGLVTERSPPVKSCASLQVSSSPTRGSSTLLTLPPRATAHSPSFSRLLCRQEALHTSSLE
AEVDGPADCGPDLGEPCGKTPSKQASLGDSLRSPPHSPRPASVCTRKHPFGQSCTSSQPA
ATGGEEVEAPDPADEEVSHITSSARSPSPEARAAVGGKPDPCRRYGVDAQPSRADPHQRP
AAEQGGGDSRSETAELKAQALEAEPAPGARRKKKMSPPCISIDPPMEDEGAAWPPVAEGG
STTLRRRTPSCEPMEGMGVDPTAKGERWGQVPCRAEHLTIPSFAFEPLDMGGPSGDLFLD
SGHRVAPEPRASSGITAPTEPHKTESPMPSNDPPEKGWGLYLKVPQSPPKKAGSPPASPT
PGDSVDEPV
NT seq 6690 nt   +upstreamnt  +downstreamnt
atgctggtcatcatgctcaactgcgtcaccctgggcatgttccggccttgcgaggacgtc
aagtgccgctcggagcgctgcagcatcctggaggccttcgacgacttcatcttcgccttc
ttcgcggtggagatggtcatcaagatggttgccctggggctgtttgggcagaagtgctac
ctgggtgacacgtggaacaggctggacttcttcatcgtcatggcaggcatgatggagtac
tccctggatggacacaacgtgagcctctcggccatcaggacagtacgtgtgctccggccc
ctccgcgccatcaaccgtgtgcccagcatgcgtatcctggtcacactgctgctggacacc
ctgcccatgctggggaacgtgctcctgctgtgcttcttcgtcttcttcatctttggcatc
gtgggcgtccagctgtgggccggcctgctgcgcaaccgctgcttcctggacagcgctttc
gtcaggaacaacaacctcaccttcctgcggccatactaccagacagaggagggcgacgag
aaccccttcatctgctcctcacgccgagacaacggcatgcagaagtgctcgcacatcccc
agccgccgtgagctgcgtgtggagtgcacgctgggctgggaggcctatgggcagccgcag
gccgagggcatgggcggcatcggccacaatgcctgcatcaactggaaccagtattacaac
atctgccgctccggcgactccaacccccacaacggcgccatcaacttcgacaacattggc
tacgcctggatcgccatcttccaggtgatcaccctggagggctgggtggacatcatgtat
tacgtcatggatgcccactccttctacaacttcatctacttcattctgctcatcatcgtg
ggctccttcttcatgatcaacctgtgcctggtggtgatcgctacgcagttctcagagacg
aagcagcgggagaaccagctgatgcgggagcagcgcgcccgctacctgtccgatgacagc
acgctggccagcttctcagagccgggcagctgctacgaagagctgctcaagtacgtgggc
cacatctgccgcaaggtgaagcggcgcagcctgcgcctctatgcacgctggcagagccgt
tggtgcaagaaggtggaccccaacagtgccctacacggacagggccccgggcaccagccg
cggcgggcaggcaggcgtgcagcctccattcaccatctggtctaccaccatcaccaccac
caccaccaccactaccacttcagccacggcagcccacgccggcctggccctgagcagggc
accagagacgccagtctggtacaggctagagcactgccctcaccaccctcacctggccct
gggccactcgatgccgagtcagtgcacagtgtgtaccacgcagactgccacgtggaaggg
ccacaggagagggcccaggtggtgcaagctgcggccaccaacaacaacctgaagctggcc
atggggctgggcgccatgaattaccccaccatcctgccctcagcaactggtggtggcaaa
ggtggcaccagccctgggcccaggggaaagcgggccagtaggacaccgggagctggaggg
catagctcccttagcctgagcagccatgacccctatgagaagatccagcatttggttggg
gaacatggactgggccgggcccccagccgcctctcaggcctgagtgtgccctgtcccctg
cccagcccccaggcgggcacgctgacctgcgagctgaaggattgtccgtactgcgctagc
gccctgggagaccctgagtttgagttcagcgactcagagagcggagactcagacggcaac
atggtctatgagttcacacaggacgtgcggcacggggaccaccgtgaccccatgcagccg
accccagggggggacacacccgcccagggcggtgtgcggaggcgggcacagcagcggatg
gcctctggcaagcatggcgggcttggccgtgtgtgggctgctgtcagtggcaagctgcgc
aggatcgtggacagcaagtacttcaaccgcggcatcatgatggccatcctcaccaacacg
ctgagcatgggcgttgagtaccacgagcagccggatgaactgaccaatgccctggagatc
agcaacatcgtgttcaccagcatgtttgccctggagatgctgctgaagctgctggcctgt
ggcccactgggctatatccggaacccctacaacatctttgacggcatcatcgtggtcatc
agcgtctgggagatcatcgggcaggcggacggtggcctgtcggtgctgcggaccttccgg
ctgctgagggtgctgaagctggtgcgcttcatgcctgcactgcggcgccagctggtggtg
ctcatgaagaccatggacaacgtggccaccttctgcatgctgctcatgctgttcatcttc
atcttcagcatcctgggtatgcacctctttggctgcaagttcagcctgaaaacagacact
ggagacacagtgcctgaccggaagaactttgactcgctgctatgggccatcgtcaccgtg
ttccagatcctcacccaggaggactggaatgtcgtcctctacaacggcatggcctccacc
tcctcctgggccgccctctacttcgtggccctgatgacctttggcaactacgtgctcttc
aacctgctggtggccatcctggtggagggcttccaggcggagggtgacgccaacagatct
gacacagatgaagacaagacatccactcacctggaggaggatttcgacaagttcagagac
ctcagggcagcagagatgaagatgtactccctggccgtgacacccaacgggcacctggag
ggccaaggcagcctgccccctcctgtcatcatgcgcacggcagccacgcccatgcccacc
cccaagagctccccaaacctggacgcggcccatagcctcctggactctcggcgtggcagc
agcagctccatggaccctcagctgggggaccagaagtctctgtccagcctccgcagctct
ccatgtacccactggggccccaacagtgcctggagcagccggcgctcaagctggaacagc
ctgggtcgcgcgcccagcctcaagcgccggagccagtgcggggagcgggagtccctgctg
tccggagagggcaaaggcagcacagacgaggaggccgaggatggcaggcccaaggtggga
gcctcaccctgcacacatgccaccccactacggcgtactgagtccctggaccaccgcggc
acgttggacgtgcagcccctgcggccagccaccctgctgcccaccaagctccacgactgc
aacgggcagatgctggccctgcccagcgagttcttcctgcgcatagacagccacaaggag
gacccagccgagtttgacgatgacatggaggatagctgctgctcacgcctgcgcaaggtg
ctggagccctataaacccgagtggtgtcggaaccgtgagccctggtcgctgtaccttttc
tccccacagaacaggttccgcgcctcctgccaaaaagtcatcgctcacaagatgttcgat
cacgtcgtcctggttttcatctttctcaactgcatcaccatcgccctggagaggccagac
atcgatcccgggagcaccgagcgcatctttctcagcgtctccaactacatcttcacggca
atcttcgtggctgagatgatggtgaaggtggtggccctaggcctggtctcgggggagcat
gcctacctgcagagcagctggaatgtgctggacgggctgctggtcctggtgtccctggtc
gacatcatcgtggccatggcctctgcgggtggtgccaagatcctgggcatcctgcgtgtg
ctgcgcctgctgcggacactccggcctctgagggtcattagccgtgctcctggcctcaag
ctggtggtggagaccctgatatcgtctcttaggcccatcggcaacatcgttctcatctgc
tgtgccttcttcatcatcttcggcatccttggggtgcagctcttcaagggcaagttctac
tactgcgagggcaccgacaccaggaacatatccaccagggcagagtgccaggctgcccac
taccgctgggtgcggcgcaagtacaacttcgacaacctgggccaggcgctgatgtccctg
ttcgtgctctcctccaaggacggctgggtgaacatcatgtatgatgggctggacgccgtg
ggcatagaccagcagccggtgcccaaccacaacccctggatgctgctctacttcatctcc
ttcctgctcatcgtcagcttcttcgtgctcaacatgtttgtgggtgtcgtggtggagaac
ttccacaagtgccggcagcaccaggaggccgaggaggcgcggcggcgcgaggagaagcgg
cagcggcgcctggagagaaaacgcaggagcactttgcccaacccagaggcccagcgccgg
ccctactacgctgactactcgcccactcgccgctccatccactcgctgtgcaccagccac
tacctcgaccttttcatcaccttcatcatcggggtcaacgtcatcaccatgtccatggag
cactacaaccagcccaagtcactggatgaggccctcaagtactgcaactacgtgttcacc
attgtcttcgtctttgaggctgtgctaaaactggtggcatttgggttccggagattcttc
aaggacaggtggaaccagctggacctggcgatcgtgctgctgtccatcatgggcatcacg
ctagaggagatcgagatgagcgcggcactgcccatcaaccccaccatcatccgcattatg
cgcgtgctccgcatcgcccgagtgctgaagctgctcaagatggccacaggcatgcgcgcc
ctgctggacacggtggttcaagcgctgccccaggtagggaacctcggcctacttttcatg
ctcctgttttttatctatgctgccctgggagtggagctgttcgggaggcttgagtgcagt
gaggacaacccatgtgagggcctgagcaggcacgccaccttctccaacttcggcatggcc
ttcctcacgctgttccgagtgtccacgggggacaactggaacgggatcatgaaggacacg
ctgagggagtgtgcccgtgaagacaagcactgcctaacctacctgccagccatctcgccc
atctactttgtcacctttgtgctggtggcccagtttgtgctggtcaacgtggtggtggcc
gtgctcatgaagcacctggaggagagcaacaaggaggcccgcgaggacgccgaactggat
gctgagctcgagctggagatggcgcaggagctgcccgctcatcccaggcccacagccccg
cagagccccagcactgggcccgaggcccccaacctcccggttgctcgaaaggtatccgtg
tccaggatgctctccctgcccaacgacagctacatgttccggcctgtggcacccgcctca
gcccctcaccgccatccactgcaggaggtagaaatggacacctacgtgggcaccacctcc
tccggcttggtcaccgagcgctcaccacctgtgaagtcctgcgcctccctccaggtctcg
tcctcccctaccaggggcagcagcaccctcctcaccctgccccctcgggccacagcccac
tcccccagctttagccgcctactctgcagacaggaggccctacacaccagctccctggaa
gcagaggttgacggccctgcggactgtggccctgacttgggggagccttgcgggaagacc
ccctcaaagcaggcatccctgggggactccctgaggtcgcctccgcactccccaaggccc
gccagtgtctgtacccgaaagcaccctttcggtcagagctgcacctccagccagccggcg
gccacaggcggggaggaggtggaggccccagacccagccgacgaggaggtcagccacatc
accagctcggcccgcagcccctcgcccgaggcccgcgcggcggtgggcggcaagccagac
ccctgcaggcgctacggtgtcgacgcccagcccagccgggcagacccgcaccagcggccc
gcggcggagcagggcggaggggacagccgctcagagacggcggagcttaaggcccaggca
ctggaggccgagccagccccaggcgcccgcaggaagaagaagatgagccccccttgcatc
tccatagacccccccatggaggacgagggtgcagcctggccccctgtagcagagggtggc
agtaccaccctgcggcggagaaccccatcctgtgagcccatggagggcatgggggtggac
cctaccgccaagggggagcggtggggccaggttccctgccgtgcagagcacctgaccatc
cccagctttgccttcgagccgttggacatggggggccccagcggagacctattcttggac
agtggtcacagggtggccccagaacccagagcttcctcggggatcacagcacccactgaa
ccccacaaaacagagtctcctatgccctccaatgatcccccagagaagggatgggggctg
tacctcaaagtcccccagagtcctccaaagaaagcagggtcccccccagccagtcccaca
ccaggcgacagtgtggatgagcctgtgtag

DBGET integrated database retrieval system