KEGG   Miniopterus natalensis: 107529888
Entry
107529888         CDS       T05883                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor isoform X1
  KO
K04135  adrenergic receptor alpha-1A
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04152  AMPK signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107529888 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    107529888 (ADRA1A)
   04152 AMPK signaling pathway
    107529888 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107529888 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107529888 (ADRA1A)
   04270 Vascular smooth muscle contraction
    107529888 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    107529888 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107529888 (ADRA1A)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107529888 (ADRA1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 107529888
NCBI-ProteinID: XP_016058948
LinkDB
Position
Unknown
AA seq 466 aa
MVFLSGNASDSSNCTHPPAPVNISKAILLGVILGSLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCSVWAAVDVLCCTASILGLCII
SIDRYIGVSYPLRYPTIVTQKRGLAALLCAWALSLVISVGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APGGGRGVPSARNKAHFSVRLLKFSREKKAAQTLGIVVGCFVLCWLPFFLVMPIGSFFPD
SKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCFRRKQSSKRVLGYTL
HPPSHGPEGQHKNLVRIPVGSGETFYKISKTDGVCEWKVLSSLPRGSARITVPKDQSACT
TARVRSKSFLQVCCCMGPTTPSHGENHQVPTIKIHTISLSENGEEV
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcctccgacagctccaactgcacgcacccgccggcgccg
gtgaacatttccaaggccattctgctgggggtgatcttggggagcctcatcattttcggg
gtactggggaacatcctagtgatcctctccgtggcctgccaccggcacctgcactcggtc
acccactactacatcgtgaacctggcggtggccgacctcctgctcacgtccacggtgctg
ccgttctccgcgatcttcgagatcctgggctactgggccttcggcagggtcttctgcagc
gtgtgggcggccgtggacgtcctgtgctgcaccgcgtccatcctggggctctgcatcatc
tccatcgaccgctacatcggcgtcagctacccgctgcgctaccccaccatcgtcacgcag
aagcggggcctggcggctctgctctgcgcctgggcgctctccctggtcatctccgtgggg
ccgctgttcggctggaggcagccggccccggaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggcgctgggctccttctacgtgccgctggccatcatc
ctggtcatgtactgccgcgtctacgtggtggccaagcgcgagagccgcggcctcaagtcc
ggcctcaagaccgacaagtcggactcggagcaggtgacgctccgcatccatcggaagaac
gccccgggcggaggcaggggggtgcccagcgccaggaacaaggcgcacttctccgtgagg
ctcctcaagttctcccgcgagaagaaggccgcccagaccctgggcatcgtggtgggctgc
ttcgtgctctgctggctgcctttcttcctagtgatgcccattgggtctttcttcccggac
tccaagccctccgaaacagtttttaaaatagcattttggctcggatacctaaatagctgc
atcaaccccattatatacccatgctccagtcaagagtttaaaaaggcctttcagaatgtc
ctgagaatccagtgtttccgcagaaagcagtcttccaaacgggtcctgggctacaccctg
cacccgcccagccatggtccggaggggcagcacaagaacctggtgcgcatccccgtgggc
tcaggagagaccttctataagatctccaagaccgacggggtctgtgaatggaaggttttg
tcttccctgcctcgtggatcggccaggattacagtgcccaaagaccagtcagcctgcacg
acagcccgggtgagaagtaaaagctttttgcaggtctgctgctgcatggggcccacgacc
cccagccatggagagaaccatcaagttccaaccattaagatccacaccatctccctcagt
gaaaacggggaggaagtctag

KEGG   Miniopterus natalensis: 107536281
Entry
107536281         CDS       T05883                                 

Gene name
ADRA1D
Definition
(RefSeq) alpha-1D adrenergic receptor
  KO
K04137  adrenergic receptor alpha-1D
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107536281 (ADRA1D)
   04022 cGMP-PKG signaling pathway
    107536281 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107536281 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107536281 (ADRA1D)
   04270 Vascular smooth muscle contraction
    107536281 (ADRA1D)
  09154 Digestive system
   04970 Salivary secretion
    107536281 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107536281 (ADRA1D)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107536281 (ADRA1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 107536281
NCBI-ProteinID: XP_016067425
LinkDB
Position
Unknown
AA seq 328 aa
MAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSTTVLPFSATMEVLGFWAFGRAF
CDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPTIMTERKAAAILAMLWAVALVVS
VGPLLGWKEPVPPDERFCSITEEVGYAVFSSVCSFYLPMAVIIVMYCRVYVVARSTTRSL
EAGVKRERGKASEVVLRIHCRGATSGADGAHRGLRSAKGHTFRSSLSVRLLKFSREKKAA
KTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSP
AFGTELPPPMPPTPGTEPSGDGEVLQRP
NT seq 987 nt   +upstreamnt  +downstreamnt
atggccgtggcgggcaacctgctggtcatcctctccgtggcctgcaaccgccacctgcag
acggtcaccaactatttcatcgtgaacctggccgtggccgacctgctgctgagcaccacg
gtgctgcccttctcggccaccatggaagtcctgggcttctgggccttcggccgggccttc
tgcgacgtgtgggccgcggtggacgtgctgtgctgcactgcctctatcctcagcctctgc
accatttccgtggaccggtacgtgggcgtgcgccactcgctcaagtaccccaccatcatg
accgagcgcaaggcggccgccatcctggcgatgctctgggccgtggccctcgtggtgtcc
gtggggcccctgctgggctggaaggagccggtgccccctgacgagcgcttctgcagcatc
acggaggaggtgggctacgccgtcttctcctccgtgtgctccttctacctgcccatggcc
gtcatcatcgtcatgtactgccgcgtgtacgtggtagcgcgcagcaccacgcgcagcctc
gaggcgggcgtcaagcgggagcgcggcaaggcctcggaggtggtgctgcgcatccactgc
cgcggcgccacctcgggcgcggacggggcgcaccgcgggttgcgcagcgccaagggccac
accttccgcagctcgctgtccgtgcgcctgctcaagttctcccgcgagaagaaggcggcc
aagacgctggccatcgtcgtgggagtcttcgtgctctgctggttccccttcttcttcgtc
ctgccacttggttccctgttcccgcagctgaagccctcggagggcgtcttcaaggtcatc
ttctggctcggctacttcaacagctgcgtgaacccgctcatctacccctgctccagccca
gccttcggcacagagctgcctcctcctatgccccccacaccaggcaccgagccttcggga
gatggggaagtgctgcagaggccctaa

KEGG   Miniopterus natalensis: 107537855
Entry
107537855         CDS       T05883                                 

Gene name
ADRA1B
Definition
(RefSeq) alpha-1B adrenergic receptor
  KO
K04136  adrenergic receptor alpha-1B
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107537855 (ADRA1B)
   04022 cGMP-PKG signaling pathway
    107537855 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537855 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107537855 (ADRA1B)
   04270 Vascular smooth muscle contraction
    107537855 (ADRA1B)
  09154 Digestive system
   04970 Salivary secretion
    107537855 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107537855 (ADRA1B)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107537855 (ADRA1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv Shisa GTP_cyclohydro2
Other DBs
NCBI-GeneID: 107537855
NCBI-ProteinID: XP_016069469
LinkDB
Position
Unknown
AA seq 324 aa
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSNNSRLPQLDITRAISVGMVLGAFIIFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRHSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMREMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLESETLLPP
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaatcccgacctggacaccggccacaacacatcagcacctgcccactggggagagttg
aaaaatgccaacttcactggccccaaccagacctccaacaactccagactgccccagctg
gacatcaccagggccatctccgtgggcatggtgctgggcgcctttatcatctttgccatc
gtgggcaacatcttagtcatcttgtctgtggcctgcaaccgtcaccttcggacacccacc
aactacttcatcgtcaacctggccatcgctgacctgctgctgagcttcaccgtgctgccc
ttctcggccgccctggaggtgctgggctactgggtgctgggccggatcttctgtgacatc
tgggccgccgtggacgtcctgtgctgcaccgcctccatcctgagcctatgcgccatctcc
atcgatcgctacattggggtgcgccactctctgcagtaccccacgctagtcacccgaagg
aaagccatcttggcgctcctcagtgtgtgggtcttgtccacagtcatctccatcgggcct
ctccttgggtggaaggagccagcccccaatgatgacaaggaatgcggggtcactgaagaa
cccttctacgcgctcttctcctcgctgggctccttctacatccctctggccgtcatcctg
gtcatgtactgccgcgtctacatcgttgccaagaggaccaccaagaacctggaggccgga
gtcatgagggagatgtcgaactccaaggagctgaccctgaggatccactccaagaacttt
cacgaggacaccctcagcagtaccaaggccaagggccacaaccccaggagctccatagct
gtcaaactttttaagttctccagggaaaagaaagcagccaagaccttgggcatagtggtc
gggatgttcatcttgtgttggctacccttcttcatcgctctaccacttgaaagtgagacg
ctcttgccaccatga

DBGET integrated database retrieval system