KEGG   Miniopterus natalensis: 107529897
Entry
107529897         CDS       T05883                                 

Gene name
RAB11B
Definition
(RefSeq) ras-related protein Rab-11B
  KO
K07905  Ras-related protein Rab-11B
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04152  AMPK signaling pathway
mna04962  Vasopressin-regulated water reabsorption
mna05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107529897 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107529897 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107529897 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107529897 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529897 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529897 (RAB11B)
   04031 GTP-binding proteins [BR:mna04031]
    107529897 (RAB11B)
Membrane trafficking [BR:mna04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    107529897 (RAB11B)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529897 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   107529897 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   107529897 (RAB11B)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    107529897 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21
Other DBs
NCBI-GeneID: 107529897
NCBI-ProteinID: XP_016058962
LinkDB
Position
Unknown
AA seq 218 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtactcatcggggactca
ggtgtggggaagagcaacctcctgtcccgcttcacccgcaatgagttcaacctggagagc
aagagcaccattggtgtggagtttgccacccgcagcatccaggtggatggcaagaccatc
aaggcgcagatttgggacactgccggccaggagcgctaccgtgccatcacctctgcgtac
taccgcggtgcagtgggtgcattgctggtgtatgacatcgccaagcacctgacatatgag
aatgtggaacgctggctgaaggagctgagggaccatgctgacagtaacattgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctacgggctgtgcccactgatgaggcccgt
gcctttgcagagaagaacaacttgtccttcattgagacctcagccttggactccaccaat
gtagaagaagctttcaagaacattctcacagagatctaccgcatcgtgtcacagaagcaa
attgcagaccgcgcagcccacgacgagtcccctggcaacaatgtggtggacattagtgtg
ccgcccactaccgatggacagaaaccgaacaagctgcagtgctgccagaacctgtga

KEGG   Miniopterus natalensis: 107533797
Entry
107533797         CDS       T05883                                 

Gene name
RAB11A
Definition
(RefSeq) ras-related protein Rab-11A
  KO
K07904  Ras-related protein Rab-11A
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04972  Pancreatic secretion
mna05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107533797 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107533797 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107533797 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107533797 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107533797 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107533797 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533797 (RAB11A)
   04031 GTP-binding proteins [BR:mna04031]
    107533797 (RAB11A)
Membrane trafficking [BR:mna04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    107533797 (RAB11A)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107533797 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   107533797 (RAB11A)
GTP-binding proteins [BR:mna04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    107533797 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 107533797
NCBI-ProteinID: XP_016064122
LinkDB
Position
Unknown
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttattggagattcc
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatcttgaaagc
aagagcaccattggagttgagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacactgctgggcaagagcgatatcgagctataacatcagcatac
tatcgtggagctgtaggtgccttactggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggtaataagagtgatttgcgtcatctcagggcagttcctacagatgaagctaga
gcttttgcagaaaaaaatggtttgtcattcattgagacatcagctctagactctacaaat
gtagaagctgcttttcagacaattctgacagagatataccgcattgtttcccagaagcaa
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggtccctattcatgtt
ccaccaaccactgaaaataagccaaaggtgcagtgctgtcagaacatataa

DBGET integrated database retrieval system