KEGG   Miniopterus natalensis: 107529906
Entry
107529906         CDS       T05883                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04380  Osteoclast differentiation
mna04530  Tight junction
mna04620  Toll-like receptor signaling pathway
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04722  Neurotrophin signaling pathway
mna04912  GnRH signaling pathway
mna04926  Relaxin signaling pathway
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05161  Hepatitis B
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529906 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107529906 (MAP2K7)
   04012 ErbB signaling pathway
    107529906 (MAP2K7)
   04668 TNF signaling pathway
    107529906 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107529906 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107529906 (MAP2K7)
   04660 T cell receptor signaling pathway
    107529906 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    107529906 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107529906 (MAP2K7)
   04926 Relaxin signaling pathway
    107529906 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107529906 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107529906 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529906 (MAP2K7)
   05016 Huntington disease
    107529906 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    107529906 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107529906 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107529906 (MAP2K7)
   05135 Yersinia infection
    107529906 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107529906 (MAP2K7)
   05161 Hepatitis B
    107529906 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107529906 (MAP2K7)
   05169 Epstein-Barr virus infection
    107529906 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107529906 (MAP2K7)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107529906 (MAP2K7)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107529906 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107529906
NCBI-ProteinID: XP_016058977
LinkDB
Position
Unknown
AA seq 455 aa
MSVSAPSHPSSPPICRFLPISAVWCLAPSPPHYDLISFLLDKSVVSVVIYRRVVFFLPFP
HPVIVITLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQQPTPPARPRHMLGLPSLFTP
RSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGH
IIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAE
KLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGI
SGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKN
CKTDFEVLTKVLQEEPPLLPSHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYE
TLEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctgtgtcagctccatcccatccttccagtcctcccatctgtcggtttctacccatc
tctgcagtttggtgcctcgcgccctcccctcctcattatgatttgatttcttttcttttg
gacaaatcggttgtttctgttgtgatttatcgtcgtgttgttttttttcttccttttccc
catccagttattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctc
cagctcccactggccaacgatggcggcagccgctcaccgtcctcggagagctccccacag
caacccacgccccctgcccggccccgtcacatgctggggctcccatccttgttcacaccc
cgaagcatggagagtatcgagattgaccagaagctgcaggagatcatgaagcagacaggc
tacctgactatcgggggccagcgctaccaggcagaaatcaatgacctagagaatttgggg
gagatgggcagtggcacctgtggccaggtatggaagatgcgtttccggaagacaggtcac
atcattgccgtcaagcaaatgcgacgctcggggaacaaggaagagaacaagcggatcctc
atggacctggatgtggtactcaagagtcacgactgcccgtacattgtgcagtgctttggg
accttcatcaccaatacggatgtcttcattgccatggagctcatgggcacctgtgctgag
aagctgaagaagcggatgcagggccccatacctgagcggatcctgggcaagatgacggta
gcgatcgtgaaagcactctactacctgaaggagaagcacggtgtgatccaccgggatgtc
aagccctccaacatcctgttggatgagcggggccagatcaagctctgcgacttcggcatc
agtggtcgccttgtcgactccaaggccaaaacacggagtgctggctgtgccgcctacatg
gcacctgagcgcattgaccccccagaccccaccaagccagactatgatatccgggctgat
gtgtggagcctgggcatctccctggtggagctggcaacaggacagtttccctacaagaac
tgtaagacggacttcgaggtcctcaccaaggtcctgcaggaagagcccccacttctgccc
agtcacatgggcttctcgggggactttcagtcattcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcactatgag
acgctggaggttgacgtggcgtcctggttcaaggatgtcatggcgaagactgagtcaccg
aggactagtggagtcctaagccaacaccacctgcccttcttcaggtag

KEGG   Miniopterus natalensis: 107544551
Entry
107544551         CDS       T05883                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04620  Toll-like receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04668  TNF signaling pathway
mna04912  GnRH signaling pathway
mna04926  Relaxin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544551 (MAP2K4)
   04012 ErbB signaling pathway
    107544551 (MAP2K4)
   04668 TNF signaling pathway
    107544551 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107544551 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    107544551 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107544551 (MAP2K4)
   04926 Relaxin signaling pathway
    107544551 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    107544551 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107544551 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107544551 (MAP2K4)
   05135 Yersinia infection
    107544551 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544551 (MAP2K4)
   05161 Hepatitis B
    107544551 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544551 (MAP2K4)
   05169 Epstein-Barr virus infection
    107544551 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107544551 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544551 (MAP2K4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107544551 (MAP2K4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE7 family
   107544551 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 107544551
NCBI-ProteinID: XP_016077942
LinkDB
Position
Unknown
AA seq 281 aa
MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICM
ELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLD
RSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLY
ELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKY
KELLKHPFILMYEERTVEVASYVCKILDQMPTTPSSPMYVD
NT seq 846 nt   +upstreamnt  +downstreamnt
atggtccacaaaccgagtggacagataatggcagtgaaaagaattcggtcaacagtggat
gaaaaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgc
ccatacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatg
gaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgat
gttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccac
ttaaaagaaaacttgaaaatcattcacagagatatcaaaccttccaatatccttctggac
agaagtggaaatattaaactctgtgactttggcatcagtggacagctcgtggattccatt
gccaagacaagagatgctgggtgtaggccgtacatggcaccggagagaatagacccgagt
gcgtcacgacaaggctatgatgtccgctctgatgtctggagtttggggatcacactgtac
gagttggccacaggccggtttccttatccaaagtggaatagtgtatttgatcaactaaca
caagtcgtgaaaggagatcctccacaactgagtaattcagaggaaagggagttctctcca
agtttcatcaactttgtcaacttgtgccttacaaaggacgaatccaaaaggccaaagtat
aaagaacttctgaaacatccctttattttaatgtatgaagaacgtaccgtagaggttgca
agctatgtttgtaaaatcctggatcaaatgccaactactcccagctcccccatgtatgtc
gattga

DBGET integrated database retrieval system