KEGG   Miniopterus natalensis: 107530014
Entry
107530014         CDS       T05883                                 

Gene name
ANO7
Definition
(RefSeq) anoctamin-7
  KO
K19501  anoctamin-7
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107530014 (ANO7)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107530014 (ANO7)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer Claudin_2
Other DBs
NCBI-GeneID: 107530014
NCBI-ProteinID: XP_016059095
LinkDB
Position
Unknown
AA seq 878 aa
MFLRSHTQEMTELVLPPGSPDVLAGTAPSEDDSSPPVAVQLNPASTSPSMAAAGLPGRVP
PEQPAQTCCSDQAPAEASSGSHCTRSRMLRRRAPEEDSAVLINMAPGMEKGDSYGSIFNT
SQTDEHQAATHRAGSPAKPRIADFVLVWEEDLRLGEQQDSTTQDKTETHRAWRETFLDNL
RVAGLHVDQRHVQDEGSVVHHVLLSASWAVLCYYAEDLRLKLPLQELPNQACNWSASLLQ
RLGVPNVLLEDVPDMPPEYYSCQFKVSKLSRFLHSDSQDSFFTSTNRHQILFEILAKTPY
GHEKKGLFGVDQLLSQGVFKAAFPLHEGPFMTPPEDLHAPGLSQRQILFQYWARWRKWHK
YQPLDHVRRYFGEKVAFYFAWLGFYTGWLLPAAVVGTLVFLVGCFMVFSDTPTQELCSSA
DSFEMCPLCLNCPFWLLSSACSLVQAGRLFDHGGTVFFSVFMALWAVLFLEYWKRKSATL
AYRWGCFDYEDIEERPRPQFAASAPTTALNPVTGEEEPHFPRRSRMRRTLAGSVLVLMMV
AAVVMCFVSITVYRTTMAILVSRSNNTLLATRASRIASLTGSMVNLVFILTISKVYVALA
HVLTRWEMHRTQTSFEDAFTLKVFIFQFVNFYSSPIYIGFFKGRFVGYPGNYHTLFGVRN
EECAAGGCLIELAQELLVIMVGKQIINNMQEMLVPKLKGRWLRSKKGKVASAAVGQAPWE
ADYELLPYEGLFDEYLEMARPTIIGSGREKVEVLRSHLPGSPHQVHVSCRYRAFRDHDGH
YSGTYWNLLAIRLAFVIVFEHVVFSIGRVLDLLVPDIPESVQIKVKREYYLAKQALAENE
TLFGTNGAKDDPPQSSAESLGPQPRWPEASRASPVPSL
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgttcctgagaagccacacccaggaaatgacggagctggttctgccacctgggtcccct
gatgtcctcgcgggcacagcaccaagtgaggatgactcgagcccacctgtggccgtccag
ctgaatcccgcctctacctcaccctccatggcggcagctgggctcccaggcagggtccca
cccgagcagccagcccagacttgttgctcagaccaggctcctgctgaggcctcttctgga
agccactgcaccaggagcaggatgctgcggagacgggccccagaggaggacagtgctgtc
ctgatcaacatggccccagggatggagaagggggactcttatgggagcatattcaacacc
tcacagacggatgaacaccaggcagccactcacagggcggggagccctgccaagccccgg
atcgcagactttgtccttgtttgggaggaagacctgaggctgggtgaacagcaggacagc
acaacccaggacaagacagagacacacagggcctggcgggagaccttcctggataacctt
cgtgtggctgggctgcatgtggaccagcgtcacgtccaggatgagggcagtgtcgtgcac
catgtcctcctcagtgcctcctgggccgtgctctgctactacgccgaagacctgcgcctg
aagctgcccctgcaggagctgcctaaccaggcctgcaactggtcagccagcctgctgcag
cggctgggtgtccccaacgtgctgctggaggatgtgcccgacatgccccccgagtattac
tcctgccagttcaaagtgagcaagctgtcgaggttcctccacagtgacagccaggacagc
ttcttcaccagcacaaacaggcaccagattctgtttgagatcctggccaagaccccgtac
ggccatgagaagaaaggtctgtttggggtcgaccagctgctgtcccagggcgtcttcaag
gcggcattccccctgcacgagggacccttcatgacgcccccggaggatctgcacgcccct
ggcctcagccagcggcagatcctgttccagtactgggcccgctggcgcaagtggcacaag
taccagcctctggaccacgtgcgcaggtacttcggggagaaggtggccttctacttcgcc
tggctcgggttctacacaggctggctcctgccggcagccgtggtgggcacgctggtgttc
ctggtgggctgcttcatggtgttctcagacacacccacgcaggagctgtgcagcagtgcc
gacagctttgagatgtgcccgctctgcctcaactgccccttctggctgctctccagcgcc
tgctccctggtccaggccggccggctcttcgaccacgggggcaccgtcttcttcagcgtg
ttcatggcgctgtgggccgtgctgttcctggagtactggaagcggaagagcgccacgctg
gcctaccgctggggctgcttcgactacgaggacatcgaggagaggccgcggccccagttt
gccgcctcggcccccacgacagccctgaaccccgtcaccggcgaggaggaaccccacttc
cccaggaggagccgcatgcgccgcacgctggccggctccgtgctggtgctgatgatggtg
gcggcggtggtcatgtgcttcgtgtccatcactgtgtaccgcaccaccatggccatcctg
gtgtccaggtcgaacaacaccctcctagcgacccgggcttcgcgcatcgccagcctcacc
ggctccatggtgaacctagtcttcattctcaccatctctaaggtctacgtggccctggcc
cacgtcctcacacggtgggaaatgcaccggacgcagaccagctttgaggacgccttcacc
ctcaaggtgttcatcttccagttcgtcaacttctactcctcgcccatctacattggcttc
ttcaagggcaggtttgtgggttacccaggcaactaccacaccttgtttggggttcgcaac
gaggagtgtgcggccggaggctgcctcatcgagctggcacaggagctcctggtcatcatg
gtgggcaagcaaatcatcaacaacatgcaggagatgctcgtcccgaagctcaagggcagg
tggcttcgctccaagaaggggaaggtggcttcagcagctgtgggccaggccccctgggag
gcggactacgagctcctgccctatgagggcctgtttgacgagtacctcgaaatggccagg
cccacaatcataggatcggggagggaaaaggtggaggtgctgaggagtcatctgcctggc
tccccgcaccaagtccacgtttcctgcaggtatcgagcattcagggaccacgatgggcat
tattccgggacctactggaaccttctggccatccgcctggcctttgtcatcgtgtttgag
catgtggtattctccatcggccgggtccttgacctcctggtacctgacatccctgagtct
gtgcagatcaaggtgaagagggagtactatttggccaagcaggcgctagccgagaatgag
actctctttgggactaatggagccaaggatgacccgccccaatcctcagcggaaagcctg
ggcccacagcctaggtggccagaagccagccgagcctccccagtcccttccctctga

DBGET integrated database retrieval system