KEGG   Miniopterus natalensis: 107530082
Entry
107530082         CDS       T05883                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04066  HIF-1 signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04350  TGF-beta signaling pathway
mna04371  Apelin signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04714  Thermogenesis
mna04910  Insulin signaling pathway
mna04931  Insulin resistance
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107530082 (RPS6KB1)
   04350 TGF-beta signaling pathway
    107530082 (RPS6KB1)
   04371 Apelin signaling pathway
    107530082 (RPS6KB1)
   04066 HIF-1 signaling pathway
    107530082 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    107530082 (RPS6KB1)
   04152 AMPK signaling pathway
    107530082 (RPS6KB1)
   04150 mTOR signaling pathway
    107530082 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107530082 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107530082 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107530082 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    107530082 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    107530082 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107530082 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530082 (RPS6KB1)
   05205 Proteoglycans in cancer
    107530082 (RPS6KB1)
   05231 Choline metabolism in cancer
    107530082 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107530082 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107530082 (RPS6KB1)
   05212 Pancreatic cancer
    107530082 (RPS6KB1)
   05225 Hepatocellular carcinoma
    107530082 (RPS6KB1)
   05226 Gastric cancer
    107530082 (RPS6KB1)
   05221 Acute myeloid leukemia
    107530082 (RPS6KB1)
   05224 Breast cancer
    107530082 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107530082 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107530082 (RPS6KB1)
   05163 Human cytomegalovirus infection
    107530082 (RPS6KB1)
   05165 Human papillomavirus infection
    107530082 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107530082 (RPS6KB1)
   01522 Endocrine resistance
    107530082 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107530082 (RPS6KB1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107530082 (RPS6KB1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107530082 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107530082
NCBI-ProteinID: XP_016059200
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEHMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggatgcgggctct
gaagatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccccgaaatcttgatgagaagtggccataatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcaccaccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactgaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagttcaagctcatccatttttcagacatattaactgggaagaattg
ctggctcggaaggtagaacccccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtttttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcgcctcgaagatttattggc
agcccacgaacacctgtcagcccggtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacgcctgtggaatacccaatggaaacaagtgga
atagagcatatggacgtgacgatgagtggggaagcttcagcaccgcttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctgcgtatgaatctatga

KEGG   Miniopterus natalensis: 107537414
Entry
107537414         CDS       T05883                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04066  HIF-1 signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04350  TGF-beta signaling pathway
mna04371  Apelin signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04714  Thermogenesis
mna04910  Insulin signaling pathway
mna04931  Insulin resistance
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05221  Acute myeloid leukemia
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107537414 (RPS6KB2)
   04350 TGF-beta signaling pathway
    107537414 (RPS6KB2)
   04371 Apelin signaling pathway
    107537414 (RPS6KB2)
   04066 HIF-1 signaling pathway
    107537414 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    107537414 (RPS6KB2)
   04152 AMPK signaling pathway
    107537414 (RPS6KB2)
   04150 mTOR signaling pathway
    107537414 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107537414 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107537414 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107537414 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    107537414 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    107537414 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107537414 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537414 (RPS6KB2)
   05205 Proteoglycans in cancer
    107537414 (RPS6KB2)
   05231 Choline metabolism in cancer
    107537414 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107537414 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107537414 (RPS6KB2)
   05212 Pancreatic cancer
    107537414 (RPS6KB2)
   05225 Hepatocellular carcinoma
    107537414 (RPS6KB2)
   05226 Gastric cancer
    107537414 (RPS6KB2)
   05221 Acute myeloid leukemia
    107537414 (RPS6KB2)
   05224 Breast cancer
    107537414 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107537414 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107537414 (RPS6KB2)
   05163 Human cytomegalovirus infection
    107537414 (RPS6KB2)
   05165 Human papillomavirus infection
    107537414 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107537414 (RPS6KB2)
   01522 Endocrine resistance
    107537414 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107537414 (RPS6KB2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107537414 (RPS6KB2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107537414 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 107537414
NCBI-ProteinID: XP_016068909
LinkDB
Position
Unknown
AA seq 487 aa
MAAVFDLDLETEEGSEGEGEGEPEFSPADVCPLAELRAAGLEPVGQYEEVELTETSVNPG
PERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRA
ERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEI
TLALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGVVTHTFCGTIEYMAP
EILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIMKGKLVLPPYLTPDARD
LVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHVNWDDLLARRVDPPFRPCLQSEEDVSQF
DTHFTRQTPVDSPDDTALSESADQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSP
RTPISPLKFSPFEGFRPSPGPPEPMEPPLPPLLPPPPPPPPSCTVPLPIRPPSGTKKSKR
GRGRPGR
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgag
ggcgagcccgagttcagccccgcggacgtgtgtccccttgccgagttgagggcggctggc
ctggagcctgtggggcagtatgaggaggtggagctgacagagaccagtgtgaaccccggc
cccgagcgcattgggccccactgctttgagctgctgcgtgtgctgggcaaagggggctat
ggcaaggtgttccaggtgagaaaggtgcagggcaccaacctgggcaaaatatatgccatg
aaagtcctgagaaaggctaaaattgtgcgcaacgccaaggacacggcgcacacacgggct
gagcggaatattctggagtcagtgaagcaccccttcattgtggaactggcctatgccttc
cagactggtggcaaactctacctcatcctcgagtgcctcagtggcggtgagctcttcacg
cacttggaacgagagggcatcttcctggaagacacggcctgtttctacctggcggagatc
acattggccctgggccacctccactcccagggcatcatctaccgggacctcaagcccgag
aacatcatgctcaacagccagggccacatcaaactgacagacttcggactctgcaaggag
tcgattcatgagggtgttgtcactcacaccttctgtggtaccatcgagtacatggcccct
gagattctggtgcgcagcggccacaaccgggcggtggactggtggagcctgggggccctg
atgtacgacatgctcactggatcgccacccttcactgcagagaatcggaagaaaactatg
gacaagatcatgaaagggaagctggtgctgcccccctacctcaccccggatgcccgggac
ctcgtcaaaaagttcctgaagaggaatcccagccaacggattgggggtggcccaggggac
gctgctgatgtgcagaggcaccccttttttcggcacgttaattgggatgatctcctggcc
cgtcgtgtggacccccctttcaggccctgtctgcagtccgaggaggatgtgagccagttt
gacacccacttcacgcggcagacgccagtggacagtccagatgacacagccctcagtgag
agcgctgaccaggccttcctgggcttcacatacgtggcgccctccgtcctggacagcatc
aaggagggcttctccttccagcccaagctgcgctcccccaggcgcctcaacagcagcccc
cggacccctatcagccccctgaagttctcaccctttgaggggttccggcccagccccggc
ccaccagagcccatggagccccctctacctcctctcctgccaccgccgccaccaccacca
ccgtcgtgcactgtcccgctccccatccgacccccctcggggactaagaagtccaagagg
ggccgtgggcgccctgggcgctag

DBGET integrated database retrieval system