KEGG   Miniopterus natalensis: 107530154Help
Entry
107530154         CDS       T05883                                 

Gene name
SLC10A2
Definition
(RefSeq) ileal sodium/bile acid cotransporter
  KO
K14342  solute carrier family 10 (sodium/bile acid cotransporter), member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107530154 (SLC10A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530154 (SLC10A2)
Transporters [BR:mna02000]
 Solute Carrier Family (SLC)
  SLC10: Sodium bile salt cotransporter
   107530154 (SLC10A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF
Motif
Other DBs
NCBI-GeneID: 107530154
NCBI-ProteinID: XP_016059302
LinkDB All DBs
Position
Unknown
AA seq 348 aa AA seqDB search
MNNSTSCLATATVCNGSSCVVPVSNFNAVLSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICIGFLCQFGIMPLVGFILSVAFDILPIQAVVVLIMGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGTIIIPYDNIGTSLVALVVPVSLGM
FVNHKWPQKAKIILKIGSITGAVLIVLIAVVGGILYQAAWIIAPKLWIIGTIFPVAGYSL
GFLMARIAGQPWHRCRTVALETGMQNTQLCSTVVQLSFTFEELNQVFTFPLIYSIFQLAF
AAIFLGVYLSYKKCYGKNNKEFSESKNNETIPESSLYKVNEGFQPHEE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcgacgagctgtttggccaccgcaacagtttgcaacggttcatcctgcgtg
gtacctgtcagcaatttcaatgccgttctaagtgtggtcctgagcaccgtcctgaccatt
ctattggctttggtgatgttctccatgggatgcaatgtggaaatcaagaaattcctgggg
cacataaagcggccgtggggcatatgtattggcttcctctgtcagtttggaatcatgccc
ctcgtgggattcatcctgtcagtggcctttgacatcctccccatccaggccgtcgtggtg
ctgatcatgggatgctgtcccggaggaactgcctccaatattttggcctattgggtcgat
ggcgacatggacctgagcgtcagcatgaccacatgctccacgctgctggccctgggaatg
atgccgctgtgcctcttaatctataccaaaatgtgggtcgactcggggacgatcataatt
ccctatgataacataggtacgtctttggtggctctcgttgtccctgtttcccttggaatg
tttgttaatcacaaatggccccagaaagccaagatcatacttaagattgggtccatcaca
ggtgcagtccttatcgtgctcatcgctgtggtgggaggaatactgtaccaagctgcctgg
atcatcgcccccaagctgtggattataggaacaatatttcctgtggctggttactctcta
gggtttcttatggctaggatagctggtcagccctggcacaggtgccgcacagttgctttg
gaaacaggaatgcagaacactcagctgtgttccaccgtagtccagctctccttcaccttt
gaggagctcaatcaggtgtttaccttcccactcatctacagcatcttccagctcgctttc
gcggcaatattcttaggagtttatttgtcatataagaaatgttatggaaaaaacaataag
gaattttcagagagcaaaaacaacgaaacaattcccgagtcatcactctataaggtgaat
gaaggatttcaaccgcatgaagagtag

DBGET integrated database retrieval system