KEGG   Miniopterus natalensis: 107530228
Entry
107530228         CDS       T05883                                 

Gene name
NSF
Definition
(RefSeq) vesicle-fusing ATPase isoform X1
  KO
K06027  vesicle-fusing ATPase [EC:3.6.4.6]
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04727  GABAergic synapse
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107530228 (NSF)
  09156 Nervous system
   04727 GABAergic synapse
    107530228 (NSF)
   04721 Synaptic vesicle cycle
    107530228 (NSF)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     107530228 (NSF)
Membrane trafficking [BR:mna04131]
 SNARE
  SNARE associated proteins
   Others
    107530228 (NSF)
SSDB
Motif
Pfam: AAA CDC48_N CDC48_2 AAA_lid_3 AAA_22 AAA_16 RuvB_N AAA_5 RNA_helicase AAA_2 AAA_14 AAA_18 TIP49 AAA_33 Mg_chelatase NACHT TsaE AAA_24 ATPase_2 AAA_17 ABC_tran AAA_28 IstB_IS21 NB-ARC AAA_7 AAA_3 ATPase Rad17 DUF1454
Other DBs
NCBI-GeneID: 107530228
NCBI-ProteinID: XP_016059391
LinkDB
Position
Unknown
AA seq 753 aa
MIIQWESMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYIFTLRTHPSVVPG
SIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMA
GEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPGTGKRQKIEVGLVV
GNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASR
VFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGES
EANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKI
DGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQ
LLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRS
DFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLEDGELLVQQTKNSDRTPLVS
VLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLS
CVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEML
TAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKEKKVWIGIKKLLMLIEMSL
QMDPEYRVRKFLALLREEGASSLDFENGLFANT
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgatcatccaatgggagagtatgcaagctgcgagatgtcctacagatgaattatcttta
accaactgtgcagttgtgaatgaaaaagatttccagtctggccagcatgtgattgtgagg
acctctcccaaccacaggtacatatttacactgaggacccatccatcagtggttccaggg
agcattgcattcagcttacctcagcgaaaatgggctggactttctattgggcaagaaata
gaagtgtcattatatacatttgacaaggccaaacaatgtattggcacaatgaccatcgag
attgatttcctgcagaaaaaaagcattgactccaacccttatgatactgacaagatggca
ggagaatttattcaacagttcaacaaccaggcattctcagtggggcaacagcttgtattt
agcttcaatgaaaagctttttggcttactagtaaaggatattgaagccatggatcccagc
atcctaaagggagagccggggacaggtaaaagacagaagattgaagtaggactggttgtt
ggaaacagtcaagttgcatttgaaaaagcagaaaattcatcactcaatcttattggcaaa
gctaaaaccaaggaaaatcgccaatctatcatcaatccagactggaactttgaaaaaatg
ggaataggaggtctggacaaggaattttcagatattttccgacgagcatttgcttcccga
gtgtttcctccagagattgtggagcagatgggttgcaaacatgttaaaggcatcctgtta
tatgggcccccaggttgtggtaagactctcttggctcgacagattggcaagatgttgaat
gcaagagagcccaaagtggtcaatgggccagaaattcttaacaaatatgtgggagaatca
gaagctaacattcgtaaactctttgctgatgctgaagaggagcaaaggaggcttggtgct
aacagtggtctgcacatcatcatctttgatgaaattgatgccatctgcaaacagagaggg
agcatggctggtagcacgggagtccacgatactgtcgtcaaccagttgctgtccaaaatt
gatggggtagagcagctgaacaacatcttagtcattggaatgaccaacagaccagatctg
atagatgaggctctccttcgacctggaagactggaagttaaaatggaaataggattaccg
gatgagaaaggtcgactgcagatccttcacatacacacagcaaggatgagagggcatcag
ttactctctgctgacgtagacattaaagagctagctgtagagaccaagaatttcagcggt
gctgaactggagggtctggtgcgagcagcacaatccactgctatgaacagacacattaag
gccagtactaaggttgaagtggacatggaaaaagcagagagcctgcaggtgaccaggagc
gacttccttgcttctttggagaatgatatcaaaccagcatttggcacaaaccaagaggat
tatgcaagttacattatgaatggtatcatcaaatggggtgatccagttactcgagttcta
gaagatggagagctgctggtccagcagaccaaaaacagtgaccgcacaccattggttagc
gtccttttggaaggccctcctcacagtgggaagactgcattagctgcaaagattgcagag
gaatccaacttcccctttatcaagatctgttctcctgataagatgattggcttttctgag
acagccaagtgtcaggccatgaagaagatctttgatgatgcatacaaatcccagctcagt
tgtgtagttgtggatgacattgagagactgcttgattatgtccctattggccctcgattt
tctaatctggtattacaggctcttcttgtgttactgaagaaggctcctcctcagggccgc
aagcttcttatcattgggaccactagccgcaaagatgtccttcaggagatggaaatgctt
accgctttcagcaccaccatccatgtgcccaacattgccacaggagagcagctcctggaa
gctttggagcttttgggcaacttcaaggataaggaacgtaccacaattgcacagcaagtc
aaagagaagaaggtctggataggaatcaagaagctactaatgttgatcgagatgtcccta
cagatggatcctgaataccgtgtgagaaaattcttggctctcttacgagaagaaggagct
agctcccttgactttgaaaatggactgtttgcaaacacatag

DBGET integrated database retrieval system